SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013438 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013438
Domain Number 1 Region: 394-537
Classification Level Classification E-value
Superfamily PH domain-like 8.91e-39
Family Third domain of FERM 0.00000398
Further Details:      
 
Domain Number 2 Region: 290-395
Classification Level Classification E-value
Superfamily Second domain of FERM 8.77e-36
Family Second domain of FERM 0.000000871
Further Details:      
 
Domain Number 3 Region: 211-288
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.48e-22
Family First domain of FERM 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013438   Gene: ENSMLUG00000014752   Transcript: ENSMLUT00000014768
Sequence length 863
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429964:661119:751126:-1 gene:ENSMLUG00000014752 transcript:ENSMLUT00000014768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEKSLVAEAENSQHQQQKEEGEGAINSGQQETQLGEVSQAAAEGDNQCEQKLKTSNGD
TPTHEDLTKNKERTSENRGLSRLFSSFLKRPKSQVSEEEGKEVESAKEKGEEGQKDIEFA
TSLDEEVILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEERTEDPDFETKEGGGVEEC
SKIEVKEESPESKAERELKASQKSIRRHRNMHCKVSLLDDTVYECVVEKHAKGQDLLKRV
CEHLNLLEEDYFGLAIWDNETSKTWLDSAKEIKKQVRGIPWNFTFNFYPPDPAQLTEDIT
RYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGADYVSDFKLAPNQTK
ELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGLL
VYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEQYESTIGFKLPSYRAAKKLWKVCV
EHHTFFRLTSTDTLPKSKFLALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRASR
SLDITAAVDSTDRSPRPTSAPAIAQSQDTEGSVPGAPAKKTVVSKAQKETEKVEVKKEEV
PPEQAEPEPTEVWKGEKTHIEVTVPTSNGDQTQKLAEKTEDLIRMRKKKRERLDGENIYI
RHSNLMLEDLDKSQEEIKKHHASISELKKNFMESVPEPRPSEWDKRLSTHSPFRTLNING
QIPTGEGPPLVKTQTVTISDTANAVKSEIPTKDVPIVHTETKTITYEAAQTDESNGDLDP
GVLLTAQTITSETTSSTTTTQITKTVKGGISETRIEKRIVITGDADIDHDQVLVQAIKEA
KEQHPDMSVTKVVVHQETEISEE
Download sequence
Identical sequences G1PQR0
ENSMLUP00000013438 ENSMLUP00000013438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]