SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013467 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013467
Domain Number 1 Region: 113-403
Classification Level Classification E-value
Superfamily L domain-like 7.6e-62
Family Internalin LRR domain 0.034
Further Details:      
 
Domain Number 2 Region: 24-155
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 1.31e-26
Family Outer arm dynein light chain 1 0.005
Further Details:      
 
Domain Number 3 Region: 1365-1455
Classification Level Classification E-value
Superfamily PDZ domain-like 3.99e-21
Family PDZ domain 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013467   Gene: ENSMLUG00000014792   Transcript: ENSMLUT00000014799
Sequence length 1458
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429767:44134190:44203216:-1 gene:ENSMLUG00000014792 transcript:ENSMLUT00000014799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTKRSLFVRLVPCRCLRGEEETVTTLDYSHCSLEQVPKEIFTFEKTLEELYLDANQIEE
LPKQLFNCQSLHKLSLPDNDLTTLPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIV
EASVNPISKLPDGFSQLLNLTQLYLNDAFLEFLPANFGRLTKLQILELRENQLKMLPKTM
NRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDGNRLTFIPGFIGSLKQLTYLDVSKN
NIEMVEEGISACENLQDLLLSSNALQQLPETIGSLKNVTTLKIDENQLMYLPDSIGGLVS
IEELDCSFNEVEALPSSIGQLTNIRTFAADHNYLQQLPPEIGRWKNITVLFLHSNKLETL
PEEMGDMQKLKVINLSDNRLKNLPFSFTKLQQLTAMWLSDNQSKPLIPLQNETDSETQKM
VLTNYMFPQQPRTEDVMFISDNESFNPSLWEEQRKQRAQVAFECDEDKDEREAPPREGNL
KRYPTPYPDELKNMVKTVQTIVHRLKDEETNEDSGKDLKPHEDQQVVNNDVGVKTSESTA
PVRSKADEREKYMIGNSIQKTNEPEAETSPGNPPVTANMKASESMKQANHDDVFEESEEL
SSDEEMKMAEMRPPLIETSIIQPKVVALSNSKKDDTKDIDSLSDEVTHNSNQNNSNCSSP
SRMSDSVSLNTDSSQDTSLCSPVKQTHIGINSKRRQEDENFNSLLQNGDILNHSTEEQFK
VHDKKDFNLPEYDLNIEERLVLIEKGIDSIATSDESHKLDHINMNLHKLITNDTFQPERI
ERSKAQDIMFGTAFLSVNAKGQAERLENGNKCPNLECVNKVNGHSEETPQSPRKTEPQDT
DPSIDMGISKSTEDLSPQRSGPVGSVVKSHSITNMETGELKIYDILSDNGLQQPSATAKV
TSIDGKNIVRSKSATLLYDQPLQVFTGSSSSSDLISGTKAIFKFDSNHNPEEPNIRGPVA
SGPQSAPQIYGPPQYNIQYSSSAAVKDTLWHSKQNPQMDHVTFPSQRLPRSESTENHSYA
NKHSANMNFSNHNNVRANTGYHLHPRLGPGRHGEMWAISPNDRLIPGATRNTIQRQSSVS
STASVNVSEPGPTRRAQIPEGDYLSYRELHSVGRTAPMMSGSQRPLSARTYSIDGPNTSR
PQSARPSVSEIPERTMSVSDFNYSRTSPSKRPNARVGSEHSLLDPPGKNKVPHDWREQVL
RHIEAKKLEKSVLSRSFNSNFTAVSSFHCGSSRDLHGSQGSLAFCVADGRGSGGHIFRHP
QTSCPGDPCQDDIFISGQHNYSSATLSHKDVPPDSLKMPLSNGQMGQPLRPQANYSQIHH
PLPQASVARHPSREQLIDYLMLKVAHQPPYTQPHCSPRQGHELARQEIRVRVEKDPELGF
SISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSL
LKTFQNTVELIIVREVSS
Download sequence
Identical sequences G1PQT8
XP_006081454.1.53796 XP_014307724.1.53796 ENSMLUP00000013467 ENSMLUP00000013467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]