SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013478 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013478
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily CAD & PB1 domains 9.03e-38
Family CAD domain 0.0000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013478   Gene: ENSMLUG00000014809   Transcript: ENSMLUT00000014810
Sequence length 219
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430173:495568:498344:1 gene:ENSMLUG00000014809 transcript:ENSMLUT00000014810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYLSALKPSSLVRSVSNMSSEFGRRVWTSPPPPQRPFRVCDHKRTVRKGLTAATRQELL
DKALETLLLSGVLTLVLEEDGTAVESEDFFQLLEDDTCLMVLESGQSWSSSRSGMLSYGL
GREKPKHSKDIARITFDVYKQNPRDLFGSLNVKATFYGLYSMSCDIQGLGPKKILREFLR
WTSTLLQGLGHMLLGISSTLRHVVEGATQWQQQGHLHPY
Download sequence
Identical sequences G1PQU9
XP_006102291.1.53796 ENSMLUP00000013478 ENSMLUP00000013478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]