SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013488 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013488
Domain Number 1 Region: 38-239
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 8-46
Classification Level Classification E-value
Superfamily PH domain-like 0.0000117
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000013488
Domain Number - Region: 556-644
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000942
Family FCH domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013488   Gene: ENSMLUG00000014817   Transcript: ENSMLUT00000014820
Sequence length 659
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429779:6926423:7068250:1 gene:ENSMLUG00000014817 transcript:ENSMLUT00000014820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDRERMTANHESYLLMAGTQHDMEDWVKSIRRVIWGPFGGGIFGQKLEETVRYEKRYGNR
LAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASL
LKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKYICRF
LDEVQSYSGVNKMSAQNLATVFGPNILRPKMEDPLTIMEGTVVVQQLMSVMISKHDRLFP
KDAELQSKPQDGMSNNNNEVQKKACVGQLQNKENNNTKDSPVRQCSWEKSDSPQRSSVDN
GSPTALSGSKTNSPRNSVHKPDVSRSPPLLVKKNPAFNKGSGIVTNGSFSSSNAEGLEKT
QTTPNGSLQARRTSSLKSSGTKMGTHSVQNGTVRMGVLNTDSLGNPMNSRGMSWLPNGYV
TLRDNKQKEQTGESGQHHRLSTYDNVHQQFSMMNFDDKQSVDSATWSTSSCEISLPENSN
SCRSSTTTCPEQDFYGGNFEDPVLDGPPQDDLSHPGDYENKSDRRSVGGRSSRATSSSDN
SETFVGNTSSNHSALHSLVSSLKQEMTKQKIEYESKIKSLEQRNLTLETEMMNLHDELDQ
ERKKFTMIEIKMRNAERAKEDAEKRNDMLQKEMEQFFSTFGELTVEPRRPERGNTIWIQ
Download sequence
Identical sequences G1PQV6
ENSMLUP00000013488 ENSMLUP00000013488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]