SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013530 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013530
Domain Number 1 Region: 234-500
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.92e-80
Family Protein kinases, catalytic subunit 0.00000000148
Further Details:      
 
Domain Number 2 Region: 124-266
Classification Level Classification E-value
Superfamily SH2 domain 7.12e-38
Family SH2 domain 0.00000986
Further Details:      
 
Domain Number 3 Region: 64-149
Classification Level Classification E-value
Superfamily SH3-domain 9.48e-22
Family SH3-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013530   Gene: ENSMLUG00000014860   Transcript: ENSMLUT00000014865
Sequence length 512
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429784:11154684:11199847:1 gene:ENSMLUG00000014860 transcript:ENSMLUT00000014865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSKRKDHLNDDGVDLKTQPVRNTDRTIYVRDPTSNKQQRPVPESQLLPGQRFQTKD
PEEQGDIVVALYPYDGIHPDDLSFRKGEKMKVLEEHGEWWKAKSLSTKREGFIPSNYVAK
VNTLETEEWFFKDITRKDAERQLLAPGNGPGAFLIRESETLKGSYSLSVRDYDPLHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKVCISPKPQKPWDKDAW
EIPRESIKLVKKLGAGQFGEVWMGYYHNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTKEEPIYIITEYMAKGSLLDFLKSDEGGKVQLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARIIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRMENCPDELYEIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
Download sequence
Identical sequences G1PQZ4 L5LIY1 S7N4R9
ENSMLUP00000013530 ENSMLUP00000013530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]