SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013558 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013558
Domain Number 1 Region: 378-508
Classification Level Classification E-value
Superfamily PH domain-like 6e-36
Family Ran-binding domain 0.00000067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013558   Gene: ENSMLUG00000014888   Transcript: ENSMLUT00000014893
Sequence length 561
Comment pep:novel scaffold:Myoluc2.0:GL430108:490812:528613:-1 gene:ENSMLUG00000014888 transcript:ENSMLUT00000014893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKLCESEKPAIAPPVFVFQKDKGQKSSAEQKDLSDSGVEPQGEAEAPHHGPGHPESTGEH
ALESPAPASASASAPEAQLPPFPRELAGRSAGGSSPEGGEVDSDREDGNYCPPVKRERTS
SLTQFPPSQSEEKSSGFRLKPPTLIHGQAPSAGVCPSQKPKEQQRSVLRPAVLQAPQPKA
LSQAVPSSGTNGLSIPADCTGTATSTSTSPDNPTQRSPPDEAPAPEEKEPQKNESSSTSE
EDSCEKKEQVAQQAFVFGQNLRDRVKLINENTEAADMENAGHPSSETPTATNYFLQYISS
SLENSTNSADATSNKFVFGQNMSERVLSPPKLNEVTSDANRENSAVESGSESSSQEATPE
KESLAESAAAYTKATARKCLLEKVEVITGEEAESNVLQIQCKLFVFDKTSQSWVERGRGL
LRLNDMASADDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIRITAMDTEDQGV
KVFLISASSKDTGQLYAALHHRILALRSRVEQEQETRTPAPEPGVAPSNEDDSDDDDVLA
PSGATGGGADNEGDGQTAGST
Download sequence
Identical sequences G1PR17
ENSMLUP00000013558 ENSMLUP00000013558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]