SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013569 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013569
Domain Number 1 Region: 461-669
Classification Level Classification E-value
Superfamily RNI-like 3.92e-17
Family 28-residue LRR 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000013569
Domain Number - Region: 25-68
Classification Level Classification E-value
Superfamily PH domain-like 0.000616
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013569   Gene: ENSMLUG00000014899   Transcript: ENSMLUT00000014907
Sequence length 673
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429802:3981137:4064169:-1 gene:ENSMLUG00000014899 transcript:ENSMLUT00000014907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTGYMENSVSYSAIEDVQLLSWENAPKYCLQLTIPGGTVLLQAANSYLRDQWFHSLQWKK
KIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSINQAPLEIVSKLLSENTNLTTQ
EHENIIVAIAPLLENNHPPPDLCEFFCKHCRERPRSMVVIEVFTPVVQRILKHNMDFGKC
PRLRLFTQEYILALNELNAGMEVVKKFIQSMHGPTGHCPHPRVLPNLVAVCLAAIYSCYE
EFINSRDNSPSLKEIRNGCQQPCDRKPTLPLRLLHPSPDLVSQEATLSEARLKSVVVASS
EIHVEVEHTSTAKPALTASAGNDSEPNLIDCLMVSPACSTMSIELGPQADRTLGCYVEIL
KLLSDYDDWRPSLASLLQPIPFPKEALAHEKFTKELKYVIQRFAEDPRQEVHSCLLSVRA
GKDGWFQLYSPGGVACDDDGELFASMVHILMGSCYKTKKFLLSLAENKLGPCMLLALRGN
QTMVEILCLMLEYNIIDNNDTQLQIISTLESTGVGKRMYEQLCDRQRELKELQRKGGPTR
LTLPSKSTDADLARLLSSGSFGNLENLSLAFTNVTSACAEHLIKLPSLKQLNLWSTQFGD
AGLRLLSEHLTMLQVLNLCETPVTDAGLLALSSMKSLCSLNMNSTKLSADTYEDLKAKLP
NLKEVDVRYTEAW
Download sequence
Identical sequences G1PR28
ENSMLUP00000013569 ENSFCAP00000004615 ENSMLUP00000013569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]