SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013584 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013584
Domain Number 1 Region: 312-434
Classification Level Classification E-value
Superfamily SH2 domain 5.79e-28
Family SH2 domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013584   Gene: ENSMLUG00000014917   Transcript: ENSMLUT00000014922
Sequence length 439
Comment pep:novel scaffold:Myoluc2.0:GL429947:2494509:2619963:1 gene:ENSMLUG00000014917 transcript:ENSMLUT00000014922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLPDDSGSTSDLIRAYRAQKERDFEDPYNGPGSSLRKLRAMCRDYCGGSGEPGGGQRAFS
ASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYISPKHRLIKVE
SAVGSAGDPPGGACSGGRTWSPTACGGKKLLNKCAASAAEESGSGKKEKVIIADDYSDPF
DAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPYEPEGQSIDS
DSESAVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDR
RRQLRAPGGGFKPIKHGSPEFCGILGERVDPAVPLEKQIWYHGAISRGEAENLLRLCKEC
SYLVRNSQTSKHDYSLSLKSNQGFMHMKLAKTKEKYILGQNSPPFDSVPEVIHYYTTRKL
PIKGAEHLSLLYPVAVRTL
Download sequence
Identical sequences G1PR41
ENSMLUP00000013584 ENSMLUP00000013584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]