SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013604 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013604
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-36
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000162
Further Details:      
 
Domain Number 2 Region: 168-264
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 8.37e-35
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000627
Further Details:      
 
Domain Number 3 Region: 343-453
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 5.23e-26
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013604   Gene: ENSMLUG00000014937   Transcript: ENSMLUT00000014943
Sequence length 466
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429840:3388525:3430028:1 gene:ENSMLUG00000014937 transcript:ENSMLUT00000014943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFV
YNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDAPNGPNLPM
ATVDIKNPEITTNRFYGPQVSNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDP
NTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPP
PPPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVGVPPPPP
NRMYPPPPPALPSSAPSGPPPPPPPLSVAGSAAPPPPPPPPPPPGPPPPPGLPSDGDHQI
PNPSGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPP
TPAPTSGIVGALMEVMQKRSKAIHSSDEDEDEDEEEDFEDDDEWED
Download sequence
Identical sequences G1PR57
ENSMLUP00000013604 ENSMLUP00000013604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]