SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013622 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013622
Domain Number 1 Region: 12-104,152-178
Classification Level Classification E-value
Superfamily SH2 domain 6.45e-29
Family SH2 domain 0.0000164
Further Details:      
 
Domain Number 2 Region: 120-208
Classification Level Classification E-value
Superfamily SH3-domain 4.67e-21
Family SH3-domain 0.00012
Further Details:      
 
Domain Number 3 Region: 225-300
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000158
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013622   Gene: ENSMLUG00000014960   Transcript: ENSMLUT00000014961
Sequence length 303
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430043:795254:817285:1 gene:ENSMLUG00000014960 transcript:ENSMLUT00000014961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSARFDSSDRSSWYMGPVSRQEAQNRLQGQRHGVFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT
AEENLEYVRTLYDFLGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRIGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSSTPGAAINPLPSTQNGPVFA
KAVQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD
ENE
Download sequence
Identical sequences G1PR75 S7PY61
XP_005875570.1.60319 XP_006099581.1.53796 ENSMLUP00000013622 ENSMLUP00000013622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]