SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013633 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013633
Domain Number 1 Region: 369-475
Classification Level Classification E-value
Superfamily PDZ domain-like 5.92e-26
Family PDZ domain 0.0024
Further Details:      
 
Domain Number 2 Region: 499-608
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-25
Family PDZ domain 0.0000599
Further Details:      
 
Domain Number 3 Region: 173-286
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000237
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013633   Gene: ENSMLUG00000014963   Transcript: ENSMLUT00000014973
Sequence length 1069
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429796:6962857:7271928:-1 gene:ENSMLUG00000014963 transcript:ENSMLUT00000014973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRA
NMPLHVRRSSDPALTGLSASVSDSNFSSEEPSRKNPTRWSTTAGFLKQNTAGSPKTRDRK
KDENYRSLPRDTSHWSNQFQRDNARSSLSASHPMVDKWLEKQEQDEDGTEDNSRVEPVGH
ADSGLENIPNFSLDDMVKLVHVPNDGGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEQE
NLFHENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPAANKEQYEQLSQSEKN
NDYSGCFSPDSQYIDNRSVNSAGLQAPQRVPRLTHQAEQMDSHPRLPQSTQPSGKPPAAP
APAPQGVFGTSVSSGYNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILP
RGAAIQDGRLKAGDRLVEVNGVDLAGKSQEEVVSLLRSTKMEGTVSLLVFRQEDAFHPRE
LNAEPSQMQIPKETKADEEDVVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHA
DLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRRSMSTEGNKRGM
IQLIVARRISKCSELKSPGSPSAPELPIETVLDDRERRISHSLYSGIERLDESPTRNAAL
SRIMGKYQLSPTVNMPQDDTVIIEDDRVPVLPPHLSDQSSSSSHDDVGFVTTDPGPWAKA
AISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDASQLDIVKTRKSKSMDLGIA
DETKLSTVDDQKAVTLQGSPSRDVGPSLGLKKSSSLESLQTAVAEVTLNGDIPFHRPRPR
IIRGRGCNESFRAAIDKSYDKPTVDDDDEGMETLEEDTEESSRSGRESVSTASDQPSYSL
ERQMNGNQEKGDKINRRKDKTGKEKKKDRDKEKDKMKAKKGMLKGLGDMFRFGKHRKDDK
IEKMSKIKIQDSLTSEEERIRMKQEQERIQAKTREFRERQARERDYAEIQDFHRTLGCDD
ELMYGGISSYEGSMALNARPQSPREGHMMDALYAQVKKSRNSKPSPVDR
Download sequence
Identical sequences G1PR84
ENSMLUP00000013633 ENSMLUP00000013633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]