SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013674 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013674
Domain Number 1 Region: 217-319,351-405,444-506
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.03e-42
Family Voltage-gated potassium channels 0.0023
Further Details:      
 
Domain Number 2 Region: 40-136
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.27e-19
Family Flavin-binding PAS domain 0.0012
Further Details:      
 
Domain Number 3 Region: 509-697
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.37e-16
Family cAMP-binding domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013674   Gene: ENSMLUG00000015015   Transcript: ENSMLUT00000015017
Sequence length 991
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429832:5084740:5344062:1 gene:ENSMLUG00000015015 transcript:ENSMLUT00000015017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMAGGRRGLVAPQNTFLENIVRRSNADTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAE
VMQKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNE
QDKVVLFLCTFSDITAFKQPIEDDSCKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVH
KHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNV
SFKTRQNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVID
LLSCLPYDVINAFENVDEVSAFMGDPGKIAFADQIPPPLEGRESQGISSLFSSLKVVRLL
RLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWL
YQLAMDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIF
AVAIMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDY
IVSTWSMSRGIDTEKVRRATSSGLHAGLCIHASRRLTRTLLSFLLKTIGKLRILALPQNT
DFCAWATKFQSHCPHVVFLFCFILLGKTEMSIQDGEISMILWKGDVFGDVFWKEATLAQS
CANVRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREE
EERMKRKNEAPLILPPDHPVRRLFQRFRQQKEARLAAERGGRDLDDLDVEKGSVLVEHAS
ANHSLVKASVVTVRESPATPVSLQTCPPRAGAPDLAKLHAPGSECLGAKAGDCAKRKGWA
RFRDACGKGEDWNKVSKAESMETLPERTKAAGEATLKKTDSCDSGITKSDLRLDNVGEAR
SPQDRSPILAEVKHSFYPIPEQTLQASILEAKLELKEDIKALHAKMTHIETQLAEILRIL
ASRRSSQSPQELFEISGPHSPESGRDIFGAS
Download sequence
Identical sequences G1PRB9
ENSMLUP00000013674 ENSMLUP00000013674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]