SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013675 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013675
Domain Number 1 Region: 98-291
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.14e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 24-87
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000000000576
Family BAR domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013675   Gene: ENSMLUG00000015011   Transcript: ENSMLUT00000015018
Sequence length 658
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431029:6352:65408:1 gene:ENSMLUG00000015011 transcript:ENSMLUT00000015018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWQQTSKSSGLSSSLQPAGAKADALREEMEEAANRVEICRDQLSADMYSFVAKEIDYANY
FQTLIEVQAEYHRKSLALLQAVLPQIKAQQEAWVEKPSFGKPLEEHLTISGREIAFPIEA
CVTMLLECGMQEEGLFRVAPSASKLKKLKAALDCCVVDVQEYSADPHAIAGALKSYLREL
PEPLMTFELYDEWIQASNIQEQEKRLQALWNACEKLPKANHSNIRYLIKFLSKLSEYQDV
NKMTPSNIAIVLGPNLLWPQAEGNITEMMTTVSLQIVGIIEPIIQHADWFFPGEIEFNIT
GNYGSPVHVNHNANYSSMPSPDMDPADRRQPEQARRPLSVATDNMMLEFYKKDGLRKIQS
MGVRVMDTSWVARRGSSSAGRKGSCAPPSTQPPAPPEELAAPLPSPLLEQPPEDPVVPSL
SPSGLGLQPWGRADQRVSASRSKELSPGSGQKGSPGSSQGAPCAGTPAGTSPGPQPADQS
PHTLRKVSKKLAPIPPKVPFGQPGAMSELPTGQPSPLSLSPTPPSTPSPYGLSYPQGYPL
ASGQLSPAAVPPLASPSSFASTLTKSRPTPKPRQRPTLPPPQPPTASLSASSPQSTEHPV
LDGMAPGESMSTDLAHFDVPSIHVELGPALRLSPLEHKLRPSVTEKRDSEEDSESTAL
Download sequence
Identical sequences G1PRC0
ENSMLUP00000013675 ENSMLUP00000013675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]