SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013690 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013690
Domain Number 1 Region: 349-421,450-651
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 6.87e-38
Family PhyH-like 0.074
Further Details:      
 
Domain Number 2 Region: 78-195
Classification Level Classification E-value
Superfamily ARID-like 6.02e-30
Family ARID domain 0.001
Further Details:      
 
Domain Number 3 Region: 308-365
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000922
Family PHD domain 0.0047
Further Details:      
 
Domain Number 4 Region: 1157-1224
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000442
Family PHD domain 0.02
Further Details:      
 
Domain Number 5 Region: 1477-1538
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000679
Family PHD domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013690   Gene: ENSMLUG00000015035   Transcript: ENSMLUT00000015035
Sequence length 1543
Comment pep:novel scaffold:Myoluc2.0:AAPE02063682:8589:13220:1 gene:ENSMLUG00000015035 transcript:ENSMLUT00000015035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPAAAPPSCPHLAPPLGGPRPLGEFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTG
ICKVRPPRDWHPPFACDVAKLHFTPRIQRLNELEAQTRVKLNFLDQIAKYWELQGSTLKI
PHVERKILDLFQLNKLVAEEGGFAVVCKDRKWTKIATKMGFAPGKGAGYHIRGHYERILH
PYNLFLSGDSVKCLQKPNLATDTKDKEYNPHDIPQRQSVQPVETCPQARQAKRMRAEAMN
IKIEPEETTEARTHNLRRRMGCPTPKYENEKDMKSSIKQEPIEKKEHLLESEREKPKSRP
KKTTSAMDLYVCLLCGSGSDVDRLLLCEWCKDSYHTFCLVPPLHHVPKGDWWCPKCVAQE
CSKPQEAFGFEQAARDYTLRAFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEED
VTVEYGADIASKEFGSGFPVRDGKVKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADIC
GMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYGAEQLESVMKRLAPE
LFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAV
NFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICRMAAKAGVLDMVVASAVQEDMAIMIE
DERALRETVRKLGVIDSERMAFELLPDDERQCIKCKTTCFVSAVSCACKPGLLVCLHHVP
ELCSCPPGKYKLQYRYTLDDLYPMMNALKLRAESYNEWAVTVNEALEAKISKKKSLASLK
ALIEESEMKKFPDNDLLRHLRLVTQDAEKCASVAQQLLNGKRQTRFRSGGGKSPNQLTVS
ELRQFVTQLYALPCALSQAPLLKDLLSRVEDFQQQSQKLLSEEVPRAAELQELLDVSFEF
DVDLPQLTEVRLRLEQARWLEEVQQACLDPSSLTLGDMRRLIDLGVGLAPYAAVEKAMAS
LQELLTVSEHWDDKAKSLLRARPRQSLTSLAMAVKEMEEIPTYLPSRAVLKDSVQRARDW
LQDVEALQAGGRVPVLDTLVELVTRGRCIPVHLSPLPRLESLVAEVQAWKECAANTFLME
NSPYSLLEVLCPRCDIGLLGSKRKQRKFKKPLPNGKKRSSRLESLSDLERALAESKETAA
AMAALGEARLQEMEALQSLRLANEGKLLAPGQEAETKVCLCQKAPAAPMVQCELCRDAFH
TGCVAVPAASPGPRIWLCPLCLRSEKPPLEKILPLLASLQRLRVRLPEGDALRYMMERTE
SWQHRAQQLLASGSLTPVQARTGPGMSHSRWPAAAGPASETSKAPQPPGTASSEPGDQDS
RSSSLQAPFSAGWSCIPLHGVSPEVSELLMEAQLLQVTLPEMQELYQTLLAKPSPAQQMG
RSSPGRPGGEKSDCCRAKREGSGSLERKLKRRPERDRLAGERWGQVRKVWAPGRKRIRLS
TPLDTDTFQLESERDYAPVRSADTHSLRSDTSSPEQEDSEDEDAICPARSCLQPEGDEVD
WVQCDGSCNQWFHQVCVGVSPETAAKEDYVCARCAGTAVPSRK
Download sequence
Identical sequences G1PRD2
ENSMLUP00000013690 ENSMLUP00000013690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]