SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013714 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000013714
Domain Number - Region: 291-339,390-495
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0068
Family BAR domain 0.059
Further Details:      
 
Domain Number - Region: 236-312
Classification Level Classification E-value
Superfamily t-snare proteins 0.0596
Family t-snare proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013714   Gene: ENSMLUG00000015055   Transcript: ENSMLUT00000015060
Sequence length 630
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429893:3111308:3140040:1 gene:ENSMLUG00000015055 transcript:ENSMLUT00000015060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKPANDGSHSELISHFKSRSEKEHLPQHISESHLSCLKEDILNEKTKLEATFKEAELAA
YSVESLLPCKDTIEEISFENANLSASNMKKKEILTKELDTFKHVKRTLEHLLRQNTNNKI
GDSLSSILEDLTDNESENTDLKKKVLEKETYIQELLCLFQNEKENALKASRFSQSVKVVH
ERLQLQIHKKEAENDKLKEYIKSLETKIAQWNLQLKKNKHETAAMKESSRQKAMALKKAS
KIYKQRLEHFTGDIENLTSQIRNQEAKLSEAISASNAWKSHYEKIVIEKTELEVQIETMK
KQINNLLEDLKKMEDQGKNSCEEILRKLHSLEHESETLNLENTRLKIRFMCRIVPGNRAN
YLFTLSYLFFYMNFKTSFAALKDEVVSVENELSELQEVEKQQKNLIEMYKTQVQKLQEAA
EMVKSRCENLLSENNLITKNKNKKLEKMRGQMESHLKELEHTRDSLTAAERRLRECQESL
EHYKETCADQAHTIRELQGQFDGNQNLLTELSLEEENYLIQLKCENLKQKLEQMDAENKE
LEKKLENQEECLKHSNLKFKEKSAEYTALARQLEAALEEGRQKVSEEIEKMSSRERALQI
KILDLETELRKKNEEQNQLVCKINSELETP
Download sequence
Identical sequences G1PRF2
ENSMLUP00000013714 ENSMLUP00000013714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]