SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013874 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013874
Domain Number 1 Region: 586-729
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 5.23e-52
Family gamma-adaptin C-terminal appendage domain-like 0.000000134
Further Details:      
 
Domain Number 2 Region: 8-154
Classification Level Classification E-value
Superfamily ENTH/VHS domain 4.25e-48
Family VHS domain 0.000000112
Further Details:      
 
Domain Number 3 Region: 172-300
Classification Level Classification E-value
Superfamily GAT-like domain 1.28e-36
Family GAT domain 0.00000653
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013874   Gene: ENSMLUG00000015225   Transcript: ENSMLUT00000015232
Sequence length 729
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430252:184536:197550:-1 gene:ENSMLUG00000015225 transcript:ENSMLUT00000015232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKVQSPQEW
EAVQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYS
WTLALPEESKIKDAYHMLKRQGIVQSDPLIPVDRTLIPSPPPRPKNPVFDDEEKSKLLAK
LLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVKLLSEMLLHYSKEDS
SEADKELMKELFDRCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEGQ
VINGEVATSTMSDSEGHHHSRNQGTLIDLAELDAPGSSTPVLAPTPPSAGIPILPPPPQA
SAPGRSRSSSQAEAPPGPNNTSNALSLLDEELLCLGLADPAPRAPPKESAGNGQWPLFQN
EQSDLDFFSPKPGTAACSPSDGPVLQPSAIPAGNSQPPLPPPFPAPVVPASVSAPKTGFL
FPTGPAPASAPKAEPTAPGYHGSALSDSSLHQLDALDQLLEEAKATSGLVKPISSSFFPG
ATASPLIPSSTSARPLLPFSTGPGSPLFQPPVFPSQGSPMKGPELSLASVHVPLESIKPS
SALPVTAYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPIRSIVLQAAVPKSMKV
KLQPPSGTELSPFSPIQPPAAITQVMLLANPLKEKARLRYRLTFALGEQLSTEVGEVDQF
PPVEQWGNL
Download sequence
Identical sequences G1PRU3
ENSMLUP00000013874 XP_006103483.1.53796 ENSMLUP00000013874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]