SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013907 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013907
Domain Number 1 Region: 864-985
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000000196
Family cAMP-binding domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013907   Gene: ENSMLUG00000015260   Transcript: ENSMLUT00000015267
Sequence length 1117
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429821:1017283:1063097:-1 gene:ENSMLUG00000015260 transcript:ENSMLUT00000015267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSTFWWAGSGHTADLLCGRSADYTFVHGYFPMLVCFITVLGGFLRSFIKNSEVIVLAVL
SLTGFVIGHLAYSFIQMHQVVYTLLRTPSFSLYCYVSPLIIFMAALDVDFYILKNVLWQV
LLTGFISFSMAFIIVGYVVIKFNKASWDLQCCLLFSMTLGIIDPIHSVNTLKTIGISKMY
TDIIRGESMIICGVTSIFFGILRNNLVHMFVFREFHVLLDFIFHIFGSILVGYWSARIIQ
FILTDLFSNTLTSIILCVSMVYMTFYIVEFLKLSGMVALITVGLNLDSLSFKPRMEIIIT
KFLIMFTTVFQQLIYTFFGIVIGCGENNYFKFNTLNFTLVLFITMNFVRLLTIVLVSPIL
MRSSYEYNWRWGVVIAWSGIKGVFNLLLAPDIYNLSDKKVESPEMIIFYVQVLSLMTMGI
NSYMMIHLARTLGLCVISLPRQMAMQNAIDHIQEIIQNTITLFKTEKILTNVNWSLVEEK
SKIKYRISFHHISTGEKEQESPTDEVLIEEARLHVAIIQMSSFEKQCQDGILDTEAARIL
IGATKSYCPIQGKFMSIYDVSTYVKARSWLIKFKKILALLEYHKDTGYFIPYGNNKFLIF
IYHIVFSEEFDYAGHIVSLMYIYPLIIHLTSVPRKLNETSLILVNYYFILLYVLQSALKI
IILKRKYFHQHWNTLEFCILIIGIIDSFCVYFVKLRPENLVLIQFTIILGYIRIFRFIPL
FKLLIPTLINIVDVQIKRRLSLMYSITKGYVKSQEDAKFLIKQISSRESIYQKLYEILET
NKRDAIKELGLIEHEDRDVVIALKTRQAIQTVIAKSLKHLAFLCSRGIIDKHEGIEMNKV
LLSKIKALNNFPMSIPPPTPDKYLHNIVWLENKDVLIEFFKERAKLAYFDYGDVICKEGE
MPQGIYLIISGMAILHSSPPTFGIDSVHRMTRQSQTLFTEYCTCGDIIGELSCLLKREIE
YTAICETILQACFISLEDLYEGFDVFWPSLEYKIWLKLALSTAYQYFESALVDEDITFQR
CVALNVAYVETLSSCNEMTLDWATMKFVIVVYGSVMDTKTEAPFLAPCILSKTCEQVQGT
SDLSKLLIIQATEPVKVSSDSKITGKGSPFSGRKSIG
Download sequence
Identical sequences G1PRX6
ENSMLUP00000013907 ENSMLUP00000013907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]