SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013909 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013909
Domain Number 1 Region: 68-406
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-81
Family Protein kinases, catalytic subunit 0.00000288
Further Details:      
 
Domain Number 2 Region: 878-928
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000927
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0083
Further Details:      
 
Domain Number 3 Region: 944-1076
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000339
Family Pleckstrin-homology domain (PH domain) 0.055
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000013909
Domain Number - Region: 1099-1166
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.0654
Family Tricorn protease domain 2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013909   Gene: ENSMLUG00000015259   Transcript: ENSMLUT00000015269
Sequence length 1551
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430329:79854:97064:-1 gene:ENSMLUG00000015259 transcript:ENSMLUT00000015269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRLRALERLARGEAGGGPGLDGLLDLLLGLHHELSSAPLRRERNVAQFLSWASPFVTK
VKELRLQRDDFEILKVIGRGAFGEVAVVRQRDSGQIFAMKMLHKWEMLKRAETACFREER
DVLVKGDSRWVTALHYAFQDEEYLYLVMDYYAGGDLLTLLSRFEDRLPPELAQFYLAEMV
LAIHSLHQLGYVHRDVKPDNILLDMNGHIRLADFGSCLRLNNSGMVDSSVAVGTPDYISP
EILQAMEEGKGHYGPQCDWWSLGVCAYELLFGETPFYAESLVETYAKIMNHEDHLQFPSD
VPDVPASAQDLIRQLLCRQEERLGRGGLDDFRNHPFFEGVDWERLASSTAPYIPELRGPV
DTSNFDVDDDTLNHPGTLPPPSHGAFSGHHLPFVGFTYTSGSPGPESSSEQLAALERKLR
CLEQEKTELSRKLQAEALQVPSDHRELEQLRKEVQTLQDRLSETLRDSKAPLSQTDGPPA
GSDSDLQQERDRLLQELAEARAELRAQEKELCRAQGRQEELLQRLRETQEREVASASQTQ
ALSSQLEEAQAARKDLQAQVATLSREVTQLQRQRERSLEKESSRVKTVHTASETNGTGSP
EGGPQEAQLRKEVAALRVQLEQARGHGPSGKEEALCRLQEENRRLSREQERLVEELEREQ
QSRQRLEGERRETEGNWEAQIADILSWVNDEKVSRGYLQALATKMAEELESLRNVGTQTL
PARPLDHQWKARRLQKMEASARLELQSALEAEIRAKQSLQEQLTQVQEAQLQAESHLQEA
EKQNRGLQQELAALREELRTRGPGADTKSSNSLIPFLPFRSSEKDSAKDPGISGEAPRPG
VEPELRPEGRRSLRLGAVFPRGPAATTAPAEGPPAKPGSHMLRPRSFPSPTKCLRCTSLM
LGLGRQALGCDACGYFCHWTCAPQAPPCPVPPDLLCTALGVHPETGTGTAYEGFLSVPRP
AGVRRGWQRVFAALSDSRLLLFDAPDPRLSPASGALLQALDLRDPQFSATPVLASDVIHA
QSKDLPRIFRVTASQLTVPPVTCTVLLLAESEGERERWLQVLGELQRLLLDTRPRPRPVY
TLKEAYDNGLSLLSHTLCAAIIDQDRLALGTEEGLFVIHLHSNDIFQVGECRRVQRLALS
PTAGLLAALCGRGPSVRLFPLAELESPEVTGAKIPESRGCQALAAGRILQARTPVLCVAV
KRQVLCYQLGPGPGPWHHRIRELQAPAPVQSLELLGDRLCVGAAGAFSLYPLLNEAAPLA
LGGNLMPEELPPSRGGLGEALGAVELSLSEFLLLFATAGVYVDSAGRKSRIHELLWPTLP
TGWGYAVPYLTVFSENSIDVFDVRKAEWVQTVPLKKVRPLNPEGSLFLYGTEKIRLTYLR
NRLAEKDEFNIPDLTDNSRRQLVRTKSKRRFFFRVSDEQRQQQRREMLKDPFVRSKLISS
PTNFNHLVHVGFTDRKPSARDPPPAPEGKGRGARSSVPQRPHSFSEASRRPASMGSDGNA
DPRTVKKKPWTSLSSESVSCPQGSLSPAASQIQVSERPRSLPPAPESESSP
Download sequence
Identical sequences G1PRX8
ENSMLUP00000013909 ENSMLUP00000013909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]