SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013973 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013973
Domain Number 1 Region: 26-165
Classification Level Classification E-value
Superfamily Ferritin-like 1.22e-16
Family half-ferritin 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013973   Gene: ENSMLUG00000015337   Transcript: ENSMLUT00000015336
Sequence length 194
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429812:106092:110663:-1 gene:ENSMLUG00000015337 transcript:ENSMLUT00000015336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAYGRRISVRFCSSRMTLDNINRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVI
QKMWDQEKDHLKKFNELMVAFRVRPTILMPFWNVVGFALGAGTALLGREGAMACTVAVEE
SIAHHYNNQIRTLMEEDPEKYEELLQVIKKFRDEELEHHDIGLEHDAELAPAYAILKKVI
QAGCSAAIYLSERF
Download sequence
Identical sequences G1PS42
ENSMLUP00000013973 ENSMLUP00000013973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]