SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013989 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013989
Domain Number 1 Region: 3992-4359
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.96e-98
Family Regulator of chromosome condensation RCC1 0.0034
Further Details:      
 
Domain Number 2 Region: 368-734
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.31e-94
Family Regulator of chromosome condensation RCC1 0.00068
Further Details:      
 
Domain Number 3 Region: 4487-4835
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.84e-90
Family Hect, E3 ligase catalytic domain 0.0000561
Further Details:      
 
Domain Number 4 Region: 2025-2207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-34
Family SPRY domain 0.01
Further Details:      
 
Domain Number 5 Region: 3421-3515,3572-3703,3733-3806
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.68e-33
Family WD40-repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000013989
Domain Number - Region: 1744-1990
Classification Level Classification E-value
Superfamily ARM repeat 0.00288
Family HspBP1 domain 0.054
Further Details:      
 
Domain Number - Region: 2743-2805
Classification Level Classification E-value
Superfamily UBA-like 0.00936
Family UBA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013989   Gene: ENSMLUG00000015305   Transcript: ENSMLUT00000015354
Sequence length 4859
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429882:2806553:2957587:1 gene:ENSMLUG00000015305 transcript:ENSMLUT00000015354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATMVPPVKLKWLEHLNSSWITEDSESIATREGVAVLYSKLVSNKEVVLLPQQVLCLKGP
QLPDFERESLSSDEQDHYLDALLSSQLALAKMVCSDSPFAGALRKRLLVLQRVFYALSNK
YHDKGKVKQQQHSPESSSGSADVHSVSERPRSSTDALIEMGVRTGLSLLFALLRQSWMMP
VSGPGLSLCNDVIHTAIEVVSSLPPLSLANESKIPPMGLDCLSQVTTFLKGVTIPNSGAD
TLGRRLASELLLGLAAQRGSLRYLLEWIEMALGASAVVNSMEKSKLLSSQEGMISFDCFM
TILMQMRRSLGSSADRSQWREPTRTSDGLCSLYEAALCLFEEVCRMASDYSRTCASPDSI
QTGDAPIVSETCEVYVWGSNSSHQLVEGTQEKILQPKLAPSFSDAQTIEAGQYCTFVIST
DGSVRACGKGSYGRLGLGDSNNQSTLKKLTFEPHRSIKKVSSSKGSDGHTLAFTTEGEVF
SWGDGDYGKLGHGNSSTQKYPKLIQGPLQGKVVVCVSAGYRHSAAVTEDGELYTWGEGDF
GRLGHGDSNSRNIPTLVKDISNVGEVSCGSSHTIALSKDGRTVWSFGGGDNGKLGHGDTN
RVYKPKVIEALQGMFIRKVCAGSQSSLSLTSTGQVYAWGCGACLGCGSSEATALRPKLIE
ELAATRIVDISIGDSHCLALSHDNEVYAWGNNSMGQCGQGNSTGPITKPKKVSGLDGIAI
QQISAGTSHSLAWTALPRDRQVVAWHRPYCVDLEESTFSHLRSFLERYCDKINSEIPPLP
FPSSREHHSFLKLCLKLLSNHLALALAGGVATSILGRQAGPLRNLLFRLMDSTVPDEIQE
VVIETLSVGATMLLPPLRERMELLHSLLPQGPDRWESLSKGQRMQLDIILTSLQDHTHVA
SLLGYSSPSDAADLSSVCTGYGNLSDQPYGTQSCHPDTHLAEILMKTLLRNLGFYTDQAF
GELEKNSDKFLLGTSSSENSQPAHLHELLCSLQKQLLAFCHINNISENSSSVALLHKHLQ
LLLPHATDIYSRSANLLKESPWNGSVGEKLRDVIYVSAAGSMLCQIVNSLLLLPVSVARP
LLSYLLDLLPPLDCLNRLLPAAALLEDQELQWPLHGGPELIDPAGVPLPQPAQSWVWLVD
LERTIALLIGRCLGGMLQGSPVSPEEQDTAYWMKTPLFSDGVEMDTPQLDKCMSCLLEVA
LSGNEEQKPFDYKLRPEIAVFVDLALGCSKEPARSLWISMQDYAVSKDWDSATLSNESLL
DTVSRFVLAALLKHTNLLSQACGESRYQPGKSLSEVYRCVYKVRSRLLACKNLELIQTRS
SSRDRWISENQDSADVDPQEHSFTRTIDEEAEMEEQAERDREEGHPEPEDEEEEREHEVM
TAGKIFQCFLSAREVARSRDRDRMNSGAGSGARSDDPPPQSQQERRVSTDLPEGQDVYTA
ACNSVIHRCALLILGVSPVIDELQKRREEGQLQQPSTSASEGGGLMTRSESLTAESRLVH
TSPNYRLIKSRSESDLSQPESDEEGYALNGRRNVDLDLASSHRKRGPIHSQLEFRNDSWA
RLKHSRDWLCNSSYSFESDFDLTKSLGVHTLIENVVSFVSGDVGNAPGFKEPEESMSTSP
QASIIAMEQQQLRAELRLEALHQILILLSGMEEKGSISLAGSRLSSGFQSSTLLTSVRLQ
FLAGCFGLGTVGHAGAKGESGRLHHYQDGIRAAKRNIQIEIQVAVHKIYQQLSATLERAL
QANKHHIEAQQRLLLVTVFALSVHYQPVDVSLAISTGLLNVLSQLCGTDTMLGQPLQLLP
KTGVSQLSTALKVASTRLLQILAITTGTYADKLSPKIVQSLLDLLCSQLKNLLSQTGVLL
MASFGEGEEDGEEEEKKLDSSGETEKRDFRAALRKQHAAELHLGDFLVFLRRVVSSKAIQ
SKMASPKWTEVLLNIASQKCSAGIPLVGNLRTRLLALHVLEAVLPACESGVEDDQMAQVV
ERLFSLLSDCMWETPIAQAKHAIQIKEKEQEIKLQKQGELEEEDENLPIQEVSFDPEKAQ
CCLVENGQILTHGSGGKGYGLASTGVTSGCYQWKFYIVKENRGNEGTCVGVSRWPVHDFN
HRTTSDMWLYRAYSGNLYHNGEQTLTLSSFTQGDFITCVLDMEARTISFGKNGEEPKLAF
EDVDAAELYPCVMFYSSNPGEKVKICDMQMRGTPRDLLPGDPICSPVAAVLAEATIQLIR
ILHRTDRWTYCINKKMMERLHKIKICIKESGQKLKKSRSVQSREENEMREEKESKEEEKS
KHNRHGLADLSELQLRTLCIEVWPVLAVIGGVDAGLRVGGRCVHRQTGRHATLLGVVKEG
STSAKVQWDEAEITISFPTFWSPSDTPLYNLEPCEPLPFDVARFRGLTASVLLDLTYLTG
IHEDMGKQSTKRHEKKHRHESEEKGDIEQKTESESALDMRTGLTSDDVKSQGTTSSKSEG
EIASFSLDPTLPGVEYQHQITEGKRKNHEHMSKIHDIPQTEIRAVQLSYLYLGAMKSLSA
LLGCSKYAELLLIPKVLAENGHNSDCASSPVVHEDVEMRAALQFLMRHMVKRAVMRSPIK
RALGLADLERAQAMIYKLVVSGLLEDQFGGKIKQEIDQQAEESDPAQQAQTPVTTSPSAS
STTSFMSSSLEDTTTATTPVTDTETVPASESPGVMPLSLLRQMFSSYPTTTVLPTRRAQT
PPISSLPTSPSDEVGRRQSLTSPDSQSARPANRTALSDPSSRLSTSPPPPAIAVPLLEMG
FSLRQIAKAMEATGARGEADAQNITVLAMWMIEHPGHEDEEEPQSGSTADSRHGAAVLGS
AGKSNDPCYLQSPGDIPSADAAEMEEGFSESPDNLDHTENAASGSGPPTRGRSAVTRRHK
FDLAARTLLARAAGLYRSVQAHRNQSRREGISLQQDPGALYDFNLDEELEIDLDDEAMEA
MFGQDLTSENDILGMWIPEVLDWPTWHVCESEDREEVVVCELCECSVVSFNQHMKRNHPG
CGRSANRQGYRSNGSYVDGWFGGECGSGNPYYLLCGSCREKYLALKTKSKTTSSERYKGQ
APDLIGKQDSVYEEDWDMLDVDEDEKLTGEEEFELLAGPLGLNDRRIVPEPVQFPDSDPL
GASVAMVTATNSMEETLMQIGCHGSVEKSSSGRITLGEQAAALANPHDRVVALRRVTAAA
QVLLSRTMVMRALSLLSVSGSSCSLAAGLESLGLTDIRTLVRLMCLAAAGRAGLSTSPSA
MGSTTERSRGGHSKANKPISCLAYLSTAVGCLASNTPSAAKLLVQLCTQNLISAATGVNL
TTVDDPIQRKFLPSFLRGIAEENKLVTSPNFVVTQALVALLADKGAKLRPNYDKSEVEKK
GPLELANALAACCLSSRLSSQHRQWAAQQLVRTLAAHDRDNQTTPQTLADMGGDLRKCSF
IKLEAHQNRVMTCVWCNKKGLLATSGNDGTIRVWNVTKKQYSLQQTCVFNRLEGDAEESL
GSPSDPSFLPVSWSISGKYLAGALEKMVNIWQVNGGKGLVDIQPHWVSSLAWPEEGPATA
WSGESPELLLVGRMDGSLGLIEVVDVSTMHRQELEHCYRKDVSVTCIAWFSEDRPFAVGY
FDGKLLLGTKEPLEKGGIVLIDAHKDTLVSMKWDPTGHILMTCAKEENVKLWGPISGCWC
CLHSLCHPSIVNGIAWCSLPGKGSKLHLLMGGCQSGLVCVWRIPQDTTQTSVATSEGWWD
QESNCQDGYRKPSGAKCVYQLRGHITPVRTVAFSSDGLALVSGGLGGLMNIWSLRDGSVL
QTVVIGSGAIQATVWIPDVGVAACSNRSKDVLVVNCTTEWAAANHVLATCRTALKQQGVL
GLNMAPCMRAFLERLPMMLQEQYAYEKPHVVCGDQLVHSPYMQCLASLAVGLHLDQLLCN
PPVPPHHQNCLPDPASWNPNEWAWLECFSTTIKAAEALTNGAQFPESFTVPDLEPVPEDE
LVLLMDNSKWINGMDEQIMSWATSRPEDWHLGGKCDVYLWGAGRHGQLAEAGRNVMVPAA
APSFSQAQQVICGQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVVT
QLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSCG
FKHSAVVTSDGKLFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQVACGLNHTLAVS
ADGSMVWAFGDGDYGKLGLGNSTAKSSPQKVDVLCGIGIKKVACGTQFSVALTKDGQVYT
FGQDRLIGLPEGRARNHNRPQQVPVLAGVVIEDVAVGAEHTLALTSAGDIYAWGSNSEGQ
LGLGHTNHVREPTLVTVLQGKSVRQISAGRCHSAAWTAPPVPPRAPGVSVPLQLGLPDAV
PPQYGALREVSIHTARARLRLLYHFSDLMYSSWRLLNLSPNNQNSTSHYNAGTWGIVQGQ
LRPLLAPRVYTLPMVRSIGKTMVQGKNYGPQITVKRISTRGRKCKPIFVQIARQVVKLNA
SDLRLPSRAWKVKLVGEGADDAGGVFDDTITEMCQELETGSVDLLIPSPNATAEVGYNRD
RFLFNPSACLDEHLMQFKFLGILMGVAIRTKKPLDLHLAPLVWKQLCCVPLALEDLEEVD
LLYVQTLHSILHLEDSGITEESFHEMIPLDSFVGQSADGKMVPIIPGGNSIPLTFSNRKE
YVERAIEYRLHEMDRQVAAVREGMSWIIPVPLLSLLTAKQLEQMVCGMPEISVEVLKKVV
RYREVDEQHQLVQWFWHTLEEFSNEERVLFMRFVSGRSRLPANTADISQRFQIMKVDRPY
DSLPTSQTCFFQLRLPPYSSQLVMAERLRYAINNCRSIDMDNYMLSRNVDNTEGSDTDY
Download sequence
Identical sequences G1PS57
ENSMLUP00000013989 ENSMLUP00000013989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]