SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013994 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013994
Domain Number 1 Region: 313-449
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0000000000000123
Family CBS-domain pair 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000013994
Domain Number - Region: 544-596,627-653
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000144
Family cAMP-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013994   Gene: ENSMLUG00000015358   Transcript: ENSMLUT00000015360
Sequence length 711
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430197:223676:237734:-1 gene:ENSMLUG00000015358 transcript:ENSMLUT00000015360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAAAGRLGWLLAALCLGHAAGEVAQGPRVLGICLEQAGSAGAAWARGGEVPAVPEATFR
LRLFGSGFGNSSWSWAAPEGAGCPEGGPAAAPGEAAAAPTGEWRALLRLRAEAEHPHSAL
LAVXXXXXXXXXXXRRCDLSAWLGAAGLLALAALARGLQLSALVLAPAEVQVLRENGSEA
ERAAPRGLESARRWASYALSALLLLACLAQAALAVLLYRAAGQRAVPAVLGSAGLAFLVA
EVLPAAVSGRWTLALAPRALALSRLAVLLTLPVALPVGQLLELAARPGRLRERVLELARG
GGDPYSDLSKGVLRYRTVEEVLTPLEDCFMLDASTVLDFGVLASIMQSGHTRIPVYEEER
SNIVDMLYLKDLAFVDPEDCTPLSTITRFYNHPLHFVFNDTKLDAVLEEFKRGKSHLAIV
QKVNNEGEGDPFYEVLGLVTLEDVIEEIIKSEILDESEDYRDTTVRKKPAALSVPLRRKE
EFSLFKVSDNEYKVKISPQLLLATQRFLSREVDVFSPLRISEKVLLHLLRHPSVNQEVRF
DQSNRLAAHHYLYQRSQPVDYFILILQGRVEVEIGKEGLKFENGAFTYYGLSALTAPSSV
HQSPVSSLQSLCHDPQPEPADGTRLSTYCPDYTVRALSDLQFIKVTRLQYLNALLASRAQ
NLPPSPENLDLQVIPGSLTRLLGDRTAAAAGSNHGGPGLPAEESPGRNPGV
Download sequence
Identical sequences G1PS60
ENSMLUP00000013994 ENSMLUP00000013994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]