SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013998 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013998
Domain Number 1 Region: 530-697
Classification Level Classification E-value
Superfamily Sec7 domain 5.36e-55
Family Sec7 domain 0.0000678
Further Details:      
 
Domain Number 2 Region: 743-878
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-28
Family Pleckstrin-homology domain (PH domain) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013998   Gene: ENSMLUG00000015363   Transcript: ENSMLUT00000015364
Sequence length 1005
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429961:223748:474500:-1 gene:ENSMLUG00000015363 transcript:ENSMLUT00000015364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DHGGSTLLPPNVTNEFPEYGTMEDGGEGLRTSLEFDAESPPCCPQGQQGVQPHPSHHSGL
DSITEGPKDVGGGSSQSHLKEQSLQPIDSLISALKATEARIASGTLQATKVLDKDAVSSL
SVQQVDKELDTASHQTQTANKLFPAGQEKPPDIPLSAEVTTGEGVLLRIQEDLTVLLSGE
AQGELSRVTANGRKGALRVQEPACPGSSLGSPAAAHSSAGSIGFLREGRSELQREHPGGC
DRGSSTGRPGRVKHVEFEGVEILWTGGKKRETWQPADFETSSERTTSPESQGFSKVPSHL
ISSAGLCNSVGFTECVGADTWRGPSERPATSSGTFPPAPLVEGGEDEVFLKENKDHLEEK
PELERDKERILDHEEHFAGGEDDILGPGYTEDSTDVYSSQFETILDNTSLYYSAESLETL
YSEPDSYFSFEMPLTPMIQQRIKEGGQFLERTSVGGQHDILSISSDGGIVMGSSSEITNG
LSGAGESIYMKGTPEIAFWGSHAGVKTGLLETHAEMGNTEILEREPSESLSNGTSSNVEA
AKRLAKRLYQLDRFKRSDVAKHLGKNNEFSRLVAEEYLKFFDFTGMTLDQSLRYFFKAFS
LVGETQERERVLIHFSNRYFYCNPDTIASQDGVHCLTCAMMLLNTDLHGHVSNIGKKMSC
QEFIANLQGVNEGGDFSKDLLKALYNSIKNEKLEWAVDDEEKKKSPSEGTDEKANGTHPK
TISRIGSTTNPFLDIPHDPNATVYKSGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGTI
LYLQKDEYKPEKSLSEDDLKNAVSVHHALASKATDYEKKPNVFKLKTADWRVLLFQAQSP
DEMQGWINKINCVAAVFSAPPFPAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQI
TTELAEHRSYPPDKKVKAKEIDEYKLKDHYLEFEQTRYETYIGILKEGGKKLLGSNGSEA
PGLKKSHSSPSLNPDSSPVTAKVKRNVSERKDHRPETPSIKQKVT
Download sequence
Identical sequences G1PS63
ENSMLUP00000013998 ENSMLUP00000013998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]