SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013999 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013999
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.45e-18
Family Ubiquitin-related 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013999   Gene: ENSMLUG00000015370   Transcript: ENSMLUT00000015365
Sequence length 133
Comment pep:novel scaffold:Myoluc2.0:GL430329:329291:331337:-1 gene:ENSMLUG00000015370 transcript:ENSMLUT00000015365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLFVRAQELHTLEVTGRETVSQIKAHVASLEGIAPEDQVVLLAGTPLEDEATLGQCGVE
ALSTLEVAARMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVV
PTFGKKKGPNANS
Download sequence
Identical sequences G1PS64 L5LDD0 S7P8J6
ENSMLUP00000013999 ENSMLUP00000013999 XP_005864282.1.60319 XP_006104411.1.53796 XP_006771674.1.95426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]