SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014043 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014043
Domain Number 1 Region: 117-295
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.26e-36
Family BCR-homology GTPase activation domain (BH-domain) 0.000000103
Further Details:      
 
Domain Number 2 Region: 615-721
Classification Level Classification E-value
Superfamily SH2 domain 7.14e-31
Family SH2 domain 0.000000653
Further Details:      
 
Domain Number 3 Region: 323-430
Classification Level Classification E-value
Superfamily SH2 domain 3.9e-30
Family SH2 domain 0.000000627
Further Details:      
 
Domain Number 4 Region: 4-83
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-16
Family SH3-domain 0.00000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014043   Gene: ENSMLUG00000015409   Transcript: ENSMLUT00000015410
Sequence length 724
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429767:42533945:42604204:-1 gene:ENSMLUG00000015409 transcript:ENSMLUT00000015410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEGYQYRALYDYKKEREEDIDLHLDDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEAETEQQALTLPDLAE
QFAPPDIAPPLLIKLVEAIEKKGLECSTLYRAQSSSNPAELRQLLDCDAASMDLETVDVQ
VLADAFKRYLSDLPNPVIPVAVYNEMISLAQEVQSSEDYLQLLKKLIRSPNIPHQYWLTL
QYLLKHFFKLSQSSSKNLLTAGVLSELFSPLLFRFPAASSENAEPLRKVIEILISTEWSE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIVD
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
Download sequence
Identical sequences G1PSA4
XP_006081444.1.53796 ENSMLUP00000014043 ENSMLUP00000014043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]