SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014074 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014074
Domain Number 1 Region: 104-467
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.5e-72
Family Ankyrin repeat 0.0000303
Further Details:      
 
Domain Number 2 Region: 583-631
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000772
Family SOCS box-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014074   Gene: ENSMLUG00000015443   Transcript: ENSMLUT00000015445
Sequence length 633
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430083:993554:1018442:-1 gene:ENSMLUG00000015443 transcript:ENSMLUT00000015445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMEISAPGTQRAIGNEEYSLYSSLSEEELVQMAIEQSLADKTRGPTTTEASLSARANRQ
PAHFYPWTRSTAPPESGSAHLGLFQGVMQKYNRNKASQLAPVDPVLKAIKEDDEEALKAM
MKAGRNLAEANKEGWLPLHEAAYYGQLSCLKALHRAYPATIDQRTLQEETALYLATCRGH
LDCLQSLLQAGAEPDISNKSRETPLYKGTACERKNVEAVRILVQYNADTNHRCNRGWTAL
HESVSRNDLEVMEILVSSGAKVESKNAYGITPLFVAAQSGQLEALRFLAKHGADINTQAS
DSASALFEACKNEHQLVVEFLLSQGADANKANKDGMLPLHVASKKGNYRIVQMLLPVTSR
TRVRRSGISPLHLAAERNHDHVLEALLGARFDVNAPLAPERSRLYEDRRSSALYFAVVNN
NAYAAELLLQAGADPNCDVISPLLVAIRHGSLRIMQLLLDHGANIDAYIATHPTSFPATI
MFSMKYLSLLKFLMDLGCDGEPCFSCTYGNGPHPPAPPPSSRFNDVPACDKAPCVVQFCE
ILSAPEVSRWAGPIIDVLLDYVGNVQLCARLKEHIDSYEDWAVIKEKAEPPRPLAHLCRL
QVRKAIGKYRLKLLDTLPLPGRLIRYLKYENTQ
Download sequence
Identical sequences G1PSD1
ENSMLUP00000014074 ENSMLUP00000014074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]