SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014093 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014093
Domain Number 1 Region: 17-164
Classification Level Classification E-value
Superfamily PH domain-like 7.52e-44
Family Phosphotyrosine-binding domain (PTB) 0.000000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014093   Gene: ENSMLUG00000015460   Transcript: ENSMLUT00000015465
Sequence length 642
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429974:1643172:1688652:-1 gene:ENSMLUG00000015460 transcript:ENSMLUT00000015465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLRQSFRRKKDVYIPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEE
AVKRLKATGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYIC
RDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTR
EGSFRVTTATELAEREEIMKQIQDAKKAEADKTVVGSSVAPGNTAPSPSSPTSPTADATA
SLEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINDLPSTMQRKTDF
PIKNAVPEVEGEAESISSLCSQITNAFSTPSEDPFSSAPMTKPVTVVAPQSPTFQANGTD
SAFHVLAAKPAHTALASVAMPVRETNPWAHALDAVNKGIAATHSGTEWGQSSGAASPGLF
QAGHRRTPSEADRWLEEVSKSVRAQQPPTSAVPLQPVLQPPPPTAISQPAPPFQGNAFLT
SQPMPVGAVPPLQPAFIPAQAYPVANGMPYPAPNVPVVGITPSQMVANVFGTAGHPQPAH
PHQSPSLVKQQTFPQYETSSACASPFFKPPAEHFNGSAAFNGVDDGRLASGDKHTEVPIG
TCPVDPFEAQWAALESKSKQRTNPSPTNPFSSDLQKTFEIEL
Download sequence
Identical sequences G1PSE9
ENSMLUP00000014093 XP_006097674.1.53796 XP_006097676.1.53796 ENSMLUP00000014093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]