SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014110 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014110
Domain Number 1 Region: 256-383
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-31
Family Second domain of FERM 0.0021
Further Details:      
 
Domain Number 2 Region: 387-489
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-25
Family Third domain of FERM 0.0026
Further Details:      
 
Domain Number 3 Region: 33-119
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000293
Family PDZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 167-218
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000537
Family Ras-binding domain, RBD 0.054
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000014110
Domain Number - Region: 1678-1725
Classification Level Classification E-value
Superfamily t-snare proteins 0.0628
Family t-snare proteins 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014110   Gene: ENSMLUG00000015476   Transcript: ENSMLUT00000015486
Sequence length 1756
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429769:28320848:28391190:-1 gene:ENSMLUG00000015476 transcript:ENSMLUT00000015486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPAATGHISPSCPQEPFSSHVMQEESANDMECEQLPAETLRQVTIHRDPIYGFGFVAGSE
RPVVVRSVRPGGPSEDKLLAGDQIVAINEEDVSEAPRERFIELIRSAKEFIVLTVLHTHQ
SPKSAFISAAKKAKLKSNPVKVRFSEQVAVGETDAKMMKKEALLLIPNVLKVFLENGQIK
SFTFDGRTTVKDVMVTLQDRLSLRYIEHFALVLEYAGPEQNHKFLLLQDKQPLAYVVQRT
HYHGMKCLFRISFFPKDPVELLHRDPAAFEYLYIQSRNDVIRERFGMDPKPEMLLGLAAL
HIYITVSATRPSQKISLKNVEKEWGLEPFLPPSLLQGIKEKNFRKSLSQQLKAHQTHPSS
GTKGSTIQAKLQYLRILNELPTFTGVLFNTVGLDEKQSATTLLVGPRHGISHVIDLKTNL
TTVLSEFSKISKIQLFRENQGVARVETSILDAKPLVLLMEWPEATNFACLIAGYCRLLMD
SRKMVFTRPTNQPLPPPMIKADYMHSAHRPVTGGHLGKKESSYVGSVGTSPRKSSRCTPP
PADSELVSFCYLHMREQRKEQESRTDVNENLIFFEETRPRTKSDPTSKSSGQGYNVVPDD
FDAASLDHEPCASRARSYTLDNSLGAEALNFYCDSCKAKLQEQLGPRKGGRPGSSRDNIV
DLMSLPPPGSEEEEEEEDESTSLLPAIAAPPPGFRDNSSDEDDSKRRAAQSQEQGRHLRG
LLYDEIPVTLIDSMQTRTVRDHAQELDDALVSTLQALEALAASEDGPHPPPPQTAGLIVL
ATITPESSLDSGHETNSSELTDMSEMMSAMKQHQNTTYFLTQHLNKDSLLTRKDLPFRIQ
SCAAQAVLTAPYSLGRPDPNPSLQPAVTGQSPGPPGARRKLPQPEAQSQRERTYALAVHP
ALSPQLNEQKNLSLLSPVPEDKGPSYTKAGLDLSLRVATPSLSEEQVSELRGNLPKEVSA
ALQQVVHTKSLPAPGGALGNPSSSGERRLEASVGKPEVSMMSGSANKNLKFKISPEVSSS
SRVTTGSRADSLHLSPQKDRLPVQSFPPKSYHLRTSRESVGKQATGEVAGKGGPEGVKPS
LHKQSTISSQGEKGQLESTPQSGKLEETSLVSRAGYPIALQSPTCQPRGHSPSFQPRGHS
PISLSRGQSPSCLPQGQSPLRPQAASRQVSTMPSRKLETTLDGAQVTSEGPTKPKSSRGP
FRLRNLFSATFPTRQKKETDERQAQLQKVKQYELEFLEELLKPPSQGELPGTEYLQPPAP
GRCSCQLRSSPIQQGPGMSREQRRSCDCKRICRGGRPQAPQTPVPGLQGREKDKVLPTQR
QPEAGPDLNLGSPTNVRRIRSTSLESRECRSDPESGISCLSTCASGGECLGAPNYRKLMR
RYSISEDQGDRASLTSGRSIHSHPWGMLPREAKEVEASSLGLGSKSKPLGSHQTLGGPSI
CPSCFLRPKGPRPMGVFLLPERRCSGKPPELDEDNENSKCCSRYCFFYRKCDIADDASDG
KDELFYSIPMKILPGMKLDEKVVPVVSRTLQVLDAATCSSSSPEASRTQEIDLRVSTFEG
SLAKISALRAHAYGLPDGFLAARLDTNELLTVLRQCVASPEARAPKPYGSQISEYKLELF
LKFKELRASCRRVANVDKSPTHMLAAITGSFQVLSSLIETFVRLVFIVRSESQRQELLAK
VEEVVRNYTFLLRAAEESTIRNLNHQQQQQQQQQQQQQQQQQAAAAMGVSPGHPPGSPTS
ATVMSTFTHPLKTLVK
Download sequence
Identical sequences G1PSG2
ENSMLUP00000014110 ENSMLUP00000014110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]