SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014180 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014180
Domain Number 1 Region: 1196-1487
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.13e-74
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000237
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000014180
Domain Number - Region: 520-710
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0282
Family BAR domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014180   Gene: ENSMLUG00000015548   Transcript: ENSMLUT00000015568
Sequence length 1666
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430314:169064:188075:1 gene:ENSMLUG00000015548 transcript:ENSMLUT00000015568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVPRMPMIWLDLKEAGDFLFQAAVKKFVLKNYGENPDAYSEELKKLELLRQNAVRVPR
DFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIQYEQACILYN
LGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPHAYSVDMSRQILTLNVNL
MLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKL
VQMKIYYFAAVAHLHMGKQAEEQQKFGEQVAYFQSALDKLSEAIKLAKGQPDTVQDALRF
AMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKL
VPMAAHEASSLYSEEKAKLLREIMAKIEDKNEVLDQFMDSMQLDPETVDNLDTYNHIPPQ
LMEKCAALSVRPDTVRNLVQSMQVLSGVFTDVEASLKDIRDLLEEDELLDQKLQEAVGQA
GASVAGSKAELAEVRREWAKYMEVHEKASFTNSELHRAMNLHVGNLRLLSGPLDQVRAAL
PTPALTPEDQAVLQNLKRILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTTDRSEMKK
LFEEQLKKYDQLRVYLEQNLAAQDNVLRALTEANVQYAAVRRALSELDQKWNSTLQTLVA
SYEAYEDLMKKSQEGKDFYADLESKVAALLERAQSTCQAREAARQQLLDRELKKKPPPRP
TAPKPLLPRREEGEAGEMGDPPEELRSLPDAFLGAAATLRLAPVPFPGSAGPGPHYLSGP
LPPGSYSGPTQVMQPRGPQAPGPPVMAMAPGPPIYAAPVYTPELGLVPRSSPQHGVVGTP
YGAIGPHPPAAGLPSAPPPQFSGPELAMGVRPATTTVDSVQAPISSHTAPRPSPSCSSQA
LLPSTPTPATVHAPIIWELSSPSQQHQPNTTILIGSLRGFQPQGKGLSPSVIPHGQKLGP
SPHRTPPRISSSSPLHLQKPKHLPNHVPGRLSHMTRFTWHHKPCLGETAMPLCYGHDQGP
LLTACPGILGLSHGLSLSPSQKNDQRFQGPPFFSVTPKNGPMLSLSAPFLNENXWAPSAP
HSPGYGPAPSPALGRRQPLSPFKAPSPASQATPSPHLVPSPAPSPGPGPVPPRPPAADPP
PCLRRGTVAADLLSSSPESQHGGTQPPGGGQPLLQPTKVDAAEGRRPQALRLIERDPYER
PERLQQLQQELEAFRGQLGDAGALDAVWRELQDAQEHDARGRSIAIARCYSLKNRHQDVM
PYDSNRVVLRSGKDDYINASRVEGLSPYCPPLVATQAPLPGTAADFWLMVHEQKVSVIVM
LVSEAEMEKQKVARYFPTERGQPMVHGALSLALSSVRTTETHVERVLSLQFRDQSLKRSL
VHLHFPTWPELGLPDSPSNLLRFIQEVHAHYLHQRPLHTPIVVHCSSGVGRTGAFALLYA
AVQEVEAGNGLPELPQLVRRMRQQRKHMLQEKLHLRFCHEAVVRHVEQLQRHGVPPPCRP
LAGTGVSQKNHLPQDSQDLVLGGDVPISSIQATIAKLSIRPPGGLDSPVACLPGPVEPPG
LLPASLPQSTQLPSSSPPPLSSPLPETPQPEEEQPVPEVPSLGPPSSSLELLASLTPEAF
SLDSSLRGKQRMSKQNFLHAHNGQGLRAAPPADDPLSLLDPLWTLN
Download sequence
Identical sequences G1PSM5
ENSMLUP00000014180 ENSMLUP00000014180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]