SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014192 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014192
Domain Number 1 Region: 135-194
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000141
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000014192
Domain Number - Region: 172-183,215-234,384-435
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000418
Family Cytochrome c3-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014192   Gene: ENSMLUG00000015570   Transcript: ENSMLUT00000015582
Sequence length 455
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430545:147626:155207:1 gene:ENSMLUG00000015570 transcript:ENSMLUT00000015582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWDAMEYDEKLARFRQAHLNPFNKQLGARQHEQRAGEEAPDVASEETLPELAPGEPEFSC
AERVMDLGLSEDHFSRPVGLFLASDIQQLRQAIEECKQVILELPEQSERQKDAVVRLIHL
RLKLQELKDPNEDEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCYYR
CHSKCLNLISKPCVRSKVSHQAEYELNICPEAGLDSQDYRCAECRAPISLRGVPSEARQC
DYTGQYYCSHCHWNDLAVIPARVVHNWDFEPRKVSRCSLRYLALMVSRPVLRLREINPLL
FNYVEELVEIRKLRQDILLMKPYFITCKEAMEARLLLQLQDRQHFVENDEMYSVQDLLDA
HTGRLGCSLTETHTLFAKHIKLDCERCQAKGFVCELCREGDVLFPFDSHTSVCSDCSAVF
HRDCYYDNSTTCPKCARLMLRKQSLFQEPGPDVDA
Download sequence
Identical sequences G1PSN4
ENSMLUP00000014192 ENSMLUP00000014192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]