SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014222 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014222
Domain Number 1 Region: 136-193
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-18
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014222   Gene: ENSMLUG00000015606   Transcript: ENSMLUT00000015616
Sequence length 657
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430197:679934:766689:1 gene:ENSMLUG00000015606 transcript:ENSMLUT00000015616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDGLLSESQLKGTLETSKRRDIYQRCIQLKQAIDENKNALQKLSKADEPAPVGNYHQKKE
EELSLLDNLTHQLQELAVSISRTTTLKVSFYNEDEEDNDDDKEESEESSGEEEETEEEEE
EEEKQENESQRQATDEECIAVGDFIAQQAGDLTFKKGEILLIIEKHPDGWWMAKNAKGNK
GLVPRTYLEPHHKEEGHESGEEGSEGDAEVAEERAEGAQVEHRTDSHWSAVQKALSEQIN
TVDVLTTMGAIPAGFRPSTLFQLLEEGNQFRASYFLQPELTPSQLAFRDLLWDAKTGTIR
SRASRVSLILTLWSCKMIPVPGVSIQLLSRHVRLCLFDGNKVLSNIHTVRATWQPKKPRT
WTFSPQVTGTLPCLLDGDCFIRSNSASPDLGILFELGISYIRNSTGERGELSCGWVFLKL
FDANGIPIPAKTYELLLNGGTPYEKGVEVDPSVSRRAQGSVFHQMMMMRRQPQLLVKLRS
LNRRSRDLLSLLPETLIGSMSYIHLLIFYRQILGDVLLKDRLSMQSADLISNPVLATFPK
LLEQPDVVDALRSSWAEKESTLKRSEKRDTEFLKAAFLLVYHDCALPLLHSTLLPPFRWA
EEETEAARWKVIADFLKQNRENQGALPALLSPEGVHEPFDISEQTYDFLGEMRQKAA
Download sequence
Identical sequences G1PSR0
ENSMLUP00000014222 ENSMLUP00000014222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]