SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014260 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014260
Domain Number 1 Region: 274-460,533-581
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.55e-41
Family Phospholipase D 0.07
Further Details:      
 
Domain Number 2 Region: 591-790
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.84e-28
Family Nuclease 0.036
Further Details:      
 
Domain Number 3 Region: 199-304
Classification Level Classification E-value
Superfamily PH domain-like 0.0000047
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 
Domain Number 4 Region: 131-192
Classification Level Classification E-value
Superfamily PX domain 0.0000109
Family PX domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014260   Gene: ENSMLUG00000015643   Transcript: ENSMLUT00000015655
Sequence length 929
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430193:634200:645949:-1 gene:ENSMLUG00000015643 transcript:ENSMLUT00000015655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASPESLFSSGGDLDSSQLQMEPDEVDTLREGEDPADRMHPFLAIYDLQPLKMHPLVFP
GVPVIAQVVRTERYTSGSKVAGLDQRCAGGGLHFFLFKKIKNIQHRGPSFCQPLGLLPFS
NFAIPYPPAREAADREMPSLPRAGPEGSTRHASSKQKYLENYLNRLLTMSFYRNYHAMTE
FLEVSQLSFIPELGSKGLEGVIRKRSGGHRVPGFTCCGRDQVCYRWSKRWLVVKDSFLLY
MCLETGTISFVQLFDPGFGVQVGKRSTETRYGVRIDTSHRSLILKCSSYRQARWWGQEIT
ELAQGPGRDFLQLHRHESYAPPRPGTLARWFVNGAGYFAAVADAILRAREEIFITDWWLS
PEIYLKRPAHSDDWRLDVMLKKKAEEGVRVSVLLFKEVELALSINSGYSKRALMLLHPNI
KVMRHPDHVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDASESAAPEPP
TACSDSTSTPDFSHNQLFWLGKDYSNLITKDWVQLDRPFEGSPDFIDRATTARMPWRDVG
VVVHGPPARDLARHFIQRWNFTKTTKAKYKTPMYPYLLPKSTSTAHQLPFTLPGGQCATV
QVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDEIVDR
ILKAHKQGQCFRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHRLKAA
MGTAWRDYISICGLRTHGELCGHPVSELIYIHSKMLIADDRTVIIGSANINDRSLLGKRD
SELAVLIEDTEMEPSLMDGVEYQAGRFALSLRKHCFSVILGADARPDLDLRDPVCDDFFQ
LWQDTAESNANIYEQIFRCLPSNATRSLRTLREYVGVEPLAIVSPPLARSELTQVKGHLV
HFPLKFLEDESLLPPLSSKEGVMPLEVWT
Download sequence
Identical sequences G1PSU6
ENSMLUP00000014260 ENSMLUP00000014260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]