SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014285 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014285
Domain Number 1 Region: 42-370
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.13e-82
Family Protein kinases, catalytic subunit 0.00000325
Further Details:      
 
Domain Number 2 Region: 931-999
Classification Level Classification E-value
Superfamily G protein-binding domain 5.23e-26
Family RhoA-binding domain 0.0000417
Further Details:      
 
Domain Number 3 Region: 1212-1261
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000401
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Domain Number 4 Region: 1103-1170,1262-1304
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000529
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000014285
Domain Number - Region: 395-500
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00889
Family Myosin rod fragments 0.0028
Further Details:      
 
Domain Number - Region: 509-612
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0523
Family Myosin rod fragments 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014285   Gene: ENSMLUG00000015664   Transcript: ENSMLUT00000015683
Sequence length 1341
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430176:717470:768241:-1 gene:ENSMLUG00000015664 transcript:ENSMLUT00000015683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYEVVKVIGRGAFGEVQ
LVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFCAFQDDKYLYM
VMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGH
LKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEM
LVGILGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTEREVRLGRNG
VEEIKQHPFFKNDQWNWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFV
GNQLPFIGFTYYRENLYTPISTVLNNRISGKSERQEKFSIIQKKLYTLEEHLSTEIQAKE
EIEQKCRSVNTRLEKVAKELEEEITLRKNVESTLRQLEREKALLQHKNAEYQRKADHEAD
KKRNLENDVNSLKDQLEDLKKRNQNSQISTEKVNQLQRQLDETNALLRTESDAAARLRKS
QAESSKQIQQLESNNRDLQDKNCLLETAKLKLEKEFINLQSVLESERRDRTHGSEIINDL
QGRISGLEEDVKNGKILLTKVEMEKRQLQERFTDLEKEKNNMEIDMTYQLKVIQQSLEQE
EAEHKTTKARLADKNKIYESIEEAKSEAMKAIEMEKKLLEERTLKQKVENLLLEAEKKCS
ILDCDLKQSQQKVNELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKM
SEKQLKQENNHLMEMKMNLEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRE
LKEECEEKTKLCKELQQKKQELDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMK
ELEIKEMMARHKQELSEKDATIASLEETNRTLTSDVANLANEKEELNNKLKDVQEQLSRL
KDEEISAAAIKAQFEKQLLTERTLKTQAVNKLAEIMNRKEPIKRGSDTDVRRKEKENRKL
HMELKSEREKLTQQMIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQAL
HMGMDSSSTGSGPGDAEADDGFPESRLEGWLSLPVRNNTKKFGWVRKYVIVSSKKILFYD
SEQDKEHSNPYMVLDIDKLFHVRPVTQTDVYRADAKEIPRIHSILYANEGESKKEQEFPV
EPVGEKSNYICHKGHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMD
KKEEIIAPCKVYYDISTAKNLLVLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTS
MKIQQNQSIRRPSRQLAPNKP
Download sequence
Identical sequences G1PSW6
ENSMLUP00000014285 ENSMLUP00000014285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]