SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014313 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014313
Domain Number 1 Region: 263-458
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.04e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000451
Further Details:      
 
Domain Number 2 Region: 13-148
Classification Level Classification E-value
Superfamily SH2 domain 6.19e-27
Family SH2 domain 0.000000367
Further Details:      
 
Domain Number 3 Region: 196-257
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.34e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014313   Gene: ENSMLUG00000015709   Transcript: ENSMLUT00000015714
Sequence length 458
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429772:7988670:8102708:1 gene:ENSMLUG00000015709 transcript:ENSMLUT00000015714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLFFSDTDEYRPPVWKSYLYQLQQEAPHPRRITCTNEVENRPKYYGREFHGRISREAADQ
LLSVAEGSYLIRESQRQPGTYTLALRFGSQTRNFRLYYDGKHFVGEKRFESIHDLVTDGL
ITLYIETKAAEYIAKMTINPIYEHIGYTTLNREPAYQKHMPVLKETHDDKDSTGQDGVSE
KRLTSLVRRATLKENEQIPKYEKVHNFKVHTFRGPHWCEYCANFMWGLIAQGVKCADCGL
NVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHITKRPMVVDMCIREIESRGLNSEG
LYRVSGFSDLIEDVKMAFDRDGEKADISVNVYEDINIITGALKLYFRDLPIPLITYDAYP
KFIESAKIMDPDEQLETLHEALKLLPPAHCETLRYLMAHLKRVTLHEKENLMNAENLGIV
FGPTLMRSPELDAMAALNDIRYQRLVVELLIKNEDILF
Download sequence
Identical sequences G1PSZ1
ENSMLUP00000014313 ENSMLUP00000014313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]