SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014326 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014326
Domain Number 1 Region: 241-422
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-52
Family SPRY domain 0.0000297
Further Details:      
 
Domain Number 2 Region: 10-70
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000011
Family B-box zinc-binding domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000014326
Domain Number - Region: 66-118
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 0.0275
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014326   Gene: ENSMLUG00000015729   Transcript: ENSMLUT00000015727
Sequence length 428
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429869:1303216:1312094:1 gene:ENSMLUG00000015729 transcript:ENSMLUT00000015727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRLQPRRGVPGEASCRAHLEPLLLFCEDDQVTLCRKCFLAQEHGSHVVRGVHEAAEKYRK
LFRELLSTLKQKLEAAKSLLAEEQENMGLVQAEEQNFKEMLKSEYKMMIRLVTEENAMNF
QNLQGYPFNPHLREAGLSPQMKFTAELEEKYQETLQRLNSLGRENMSKLHESEVRLYEQI
ISLHSVTAELEKKCGEPSLVLLKNIINSKFKLRSGVSLLCQGLEPARITDPSLCQRPGLS
EVLELFQRPITLDPKTAHPCLVLSEDLRSVRLRNVQQDVPGNPEIFDFGASVLGVESFTS
GRHYWEVDVEKTTSWQLGIYEDSAARLMPKASEGKILLMGARMGTKYTLWVFPPLKGMYL
EEQMHKVGVFLDYKYGQISFYDVTKRFLIYNFSDLVFKGALRPIFSLCFPNEGTNSDSLS
ICLPDVFV
Download sequence
Identical sequences G1PT01
ENSMLUP00000014326 ENSMLUP00000014326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]