SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014391 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014391
Domain Number 1 Region: 122-312
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.27e-39
Family cAMP-binding domain 0.0000000903
Further Details:      
 
Domain Number 2 Region: 5-141
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000733
Family Voltage-gated potassium channels 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014391   Gene: ENSMLUG00000015787   Transcript: ENSMLUT00000015799
Sequence length 608
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429920:1130454:1252669:-1 gene:ENSMLUG00000015787 transcript:ENSMLUT00000015799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WSQIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPSDCWVSLNKMVNDS
WGKQYSYALFKAMSHMLCIGYGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSL
DSSRRQYQEKFKQGKEFLHFHLIFVNDMQYKIHRRHGHMFKGPLYFSEQLLSPAGSLLRR
EIVNFNCRKLVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGV
AGVITKSSKEMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMM
RRAFETVAIDRLDRIGKKNSILLQKFQKDLNTGVFNNQENEILKQIVKHDREMVQAIAPI
SYPQMPAPNAASTATPTSRMRTQSPPVYTATSLSPSNLHSPSPSTQTPQPSAILSPCSYT
TAVCSPPVQSPLAARTFHYASPTASQLSLVHPPPQPPAPQPPPPPPQQPPQPQTPSGSST
PKTDVHKSTQALHNASLSREVRPLSASQPSLPHEVSTPISRPHPTVGESLASIPQPVPAV
HGGSLQAGGRGTVPQRVTLFRQMSSGAIPPTRGVPPAPPPPAAPLQKEPSSVLKTDPEVE
KPRFSSNL
Download sequence
Identical sequences G1PT53
ENSMLUP00000014391 ENSMLUP00000014391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]