SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014404 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014404
Domain Number 1 Region: 184-198,383-598
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.29e-58
Family Nuclear receptor ligand-binding domain 0.00012
Further Details:      
 
Domain Number 2 Region: 116-197
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-29
Family Nuclear receptor 0.0000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014404   Gene: ENSMLUG00000015807   Transcript: ENSMLUT00000015813
Sequence length 611
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429777:6748036:6776232:1 gene:ENSMLUG00000015807 transcript:ENSMLUT00000015813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATIEEIAHQIIEQQMGEDCERAVGHPPRSPRLERVQAGLRRGTAPRPPPCTDFVHQASS
PLLLSSTSSLIKEILGECPLKIGFHIFFNEKLIKENSFQFLTDNSSSDQGPNKIFDLCVV
CGDKASGRHYGAVTCEGCKGFFKRSIRKNLVYSCRGSKDCIINKHHRNRCQYCRLQRCIA
FGMKQDSVQCERKPIEVSREKSSNCAASTEKIYIRKDLRSPLAATPTFVTDSETARSAGL
LDPGMFVNIHPSGIKTESSMLMTPDKADTCQGDLSTLASVVTSLANLGKTKDLFQNSNKM
SMIEGLSNGDASLCEFNQEIHTNGDVSRAFDTLAKALNPGESTACQSSVEGMEGNVHLIA
GDSSINYIEKEGPLLSDSHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSF
QALGQENSISLVKAYWNELFTLGLAQCWQVMNVATILATFVNCLHSSLQQVKDKMSTERR
KLLMEHIFKLQEFCNSMVKLCVDGYEYAYLKAIVLFSPDHPGLENMEQIEKFQEKAYVEF
QDYITRTYPDDTYRLSRLLLRLPALRLMNATITEELFFKGLIGNVRIDSVIPHILKMEPA
DYNSQIIGHSI
Download sequence
Identical sequences G1PT64
ENSMLUP00000014404 ENSMLUP00000014404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]