SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014421 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014421
Domain Number 1 Region: 65-192
Classification Level Classification E-value
Superfamily PH domain-like 3.84e-45
Family Phosphotyrosine-binding domain (PTB) 0.0001
Further Details:      
 
Domain Number 2 Region: 540-614
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000118
Family SH3-domain 0.0000689
Further Details:      
 
Domain Number 3 Region: 734-787
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000897
Family Pointed domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014421   Gene: ENSMLUG00000015815   Transcript: ENSMLUT00000015830
Sequence length 830
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429777:14043176:14111163:-1 gene:ENSMLUG00000015815 transcript:ENSMLUT00000015830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKATMNGHISNHPGGFGMYAPQMNGYGSPPTFSQMDREQSSKTSAKALYEQRKNYARDSI
SSVSDISQYRVEETLDYLVLDRKDAMITIDDGIRKLKLLDAKGKVWTQDMILQVDDRAVS
LIDLESKNELENFPLNTIQHCQAVMHSCNYDSILALVCKEPTQNKPDLHLFQCDEIKANL
ITEDIESAISDSKGGKQKRRPDALRMISKADPGIPPPPRAPAPVPPGTVTQVDVRSRVAA
WSAWAADQGDFEKLRQYHGHEETPEMTAARIDRDVQILNHILDDIEFFITKLQKAAEAFS
ELSKRKKTKKGKRKGPGEGVLTLRAKPPPPDEFIDCFQKFKHGFNLLAKLKSHIQNPSAA
DLVHFLFTPLNMVVQATGGPELASSVLSPLLTKDTIDFLNYTVNTDERQLWMSLGETWMK
ASYRTEWPKEQFIAPYVPRFRSGWEPPMLNFMGAPLEQDLYQLAGTVANVAEHQHRHEAK
RYSTEQSSVSEYFPPPPEGYAFNSIYTRGPHLDQGDTAAAFKPTPNRHVDRNYDPQATQP
KKYAKSKYDFAARNNSELSVQKDSILEILDDRKQWWKVRNANGESGFVPNNILDIVRSTE
SGLGRADPPYTHTIQKQRMEYGPKPTDPPSAPSPPPTPAPVPVPLPPTTPAPVPVSKAPA
NVTRQNSSSSDSGGSFMRDSQRHKQLPVDRRKSQMEEVQDELIHRLTIGRSAAQKKFHVP
RQNVPVVNITYESTPEDVKTWLQSKGFSPVTVNSLGVLNGAQLFSLNKDELKTVCPEGAR
VFNQITVQKAALEDSSGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH
Download sequence
Identical sequences G1PT77
ENSMLUP00000014421 ENSMLUP00000014421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]