SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014433 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014433
Domain Number 1 Region: 846-1058
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.16e-51
Family DBL homology domain (DH-domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 1221-1406
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-26
Family Pleckstrin-homology domain (PH domain) 0.00000991
Further Details:      
 
Domain Number 3 Region: 1047-1167
Classification Level Classification E-value
Superfamily PH domain-like 9.56e-26
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014433   Gene: ENSMLUG00000015828   Transcript: ENSMLUT00000015843
Sequence length 1410
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429777:6619717:6731593:1 gene:ENSMLUG00000015828 transcript:ENSMLUT00000015843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFFFLEIKKPPLAPKPKFVANNKSVPPPIAPKPDIVISSVPQSTKKTKPAIAPKPKVLKS
SPVCDIRQSPSRKTIVNLEEHKQELPESADSSSCKKVGHQSCGYILPMCSCSLGNRENLC
AKQLVLESLEMPENLENSKIDEFSSAIKAMSRNDFNGEMVKSQSTVSILEEKFKDVLTNS
PFISPQKHTSTDNSETNEGCNSNGQFRIEFSDLTPSQSSFEKLPDHYCLLQLPTDELQNI
ETCQDDSEKSHICFHSSEQEALAHASDGVSKNSKVKDLGPLEVHLVSCTSKFPTPKPRKT
RATRLLRQEHIDTPSESTEKPENLDSNSSCLFEDSLKNNEIIYQNVLYNQEQVNKVKPGK
KSELNVDSNSDRQNLVDSQKAMCHETSSSEEMTPSLDTDSNLSSDSKTVDGSSMSPAMDK
RTSFIRCSTVSMSLPKQLKLACNKRLPMACNLGGAVPQMQKESTMKDVSSSKIVPKKPQR
HSLPAAGMLKKAASEELMEKSSYSSNEEKKDLERNHLQQLCAQNHGTSSSFEMSKRTLEK
PVWKLPHPILPFKGNPESLKSITTSSNSEASNALTKPRAKSLSAVDMDRCTKPCKDSQRK
PSLKKLLNMKLSICFMKSDFQKFWSKSSQLEGTIAGRLSGEEGKEIESDWHGVLVEDKRN
KPIKSYSADNYSLESQKKRKKSRGQSSATNGPRAESLDDQMLSREATSQAPCKSVTSDYA
PDYENVRHYEEIPEYENFPLAMAVGKTLELERQNPSSMEDTDANVYEIEDLYEASDGQLQ
LEPIQQHSRNSCGASQEVHSDVDLGLGDLPSDEEEIINSSDEDDVSSGSSKGEPDLLEDK
QDEDTGIKSKVHYIAKEIMSSEKVFVDVLKLLHIDFRDAVAHASRQLGKPVIEDRILNQI
LYYLPQLYELNRDLLKELEERVSNWTEQQRIADIFVKKGPYLKMYSTYIKEFDKNIALLD
EQCKKNPGFAAVVREFEMSPRCANLALKHYLLKPVQRIPQYRLLLTVLDYLKNLLEDSGD
YRNTQDALAVVIEVANHANDTMKQGDNFQKLMQIQYSLNGHHEIVQPGRVFLKEGTLMKL
SRKDMQPRVFFLFNDALLYTTPVQSGMYKLNNMLSLAGMKVKKPTQEAYQNELQIESVER
SFILSASSATERDEWLEAISRSIEEYAKKRITFCPSRSLDEADSENKEEVCPLGSKAPIW
IPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQACSSNKCGLDYLKNQPARVCEHCFQE
LQKLDHQHSPKIGSPGNHKSSSALSSVLQSIPSGRKQKKIPAALKEVSANTEDSSMSGYL
YRSKGHKKPWKHFWFVIKNKVLYTYAASEDVAAMESQPLLGFTVTEVKDENSESRVFQLL
HKNMVFYVFKADDAHSAQKWIEAFQEGTIL
Download sequence
Identical sequences G1PT88
ENSMLUP00000014433 ENSMLUP00000014433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]