SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014437 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014437
Domain Number 1 Region: 131-241
Classification Level Classification E-value
Superfamily PH domain-like 9.43e-34
Family Phosphotyrosine-binding domain (PTB) 0.0000528
Further Details:      
 
Domain Number 2 Region: 7-109
Classification Level Classification E-value
Superfamily PH domain-like 6.31e-17
Family Pleckstrin-homology domain (PH domain) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014437   Gene: ENSMLUG00000015839   Transcript: ENSMLUT00000015847
Sequence length 326
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430415:54218:60204:-1 gene:ENSMLUG00000015839 transcript:ENSMLUT00000015847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATNFNDIVKQGYVKMKSRKLGIYRRCWLVFRKSSSKGPQRLEKYPDEKSVCLRGCPKVT
EISNVKCVTRLPKETKRQAVAIIFTDDSARTFTCDSELEAEEWYKTLSVECLGSRLNDIS
LGEPDLLAPGVQCEQTDRFNVFLLPCPNLDVYGECKLQITHENIYLWDIHNPRVKLVSWP
LCSLRRYGRDTTRFTFEAGRMCDAGEGLYTFQTQEGEQIYQRVHSATLAIAEQHKRVLLE
MEKNVRLLNKGTEHYSYPCTPTTMLPRSAYWHHITGSQNIAEASSYGVRGMGAAQASSET
DLLDRFILLKPKPSQGDSSEARTPAQ
Download sequence
Identical sequences G1PT92
ENSMLUP00000014437 ENSMLUP00000014437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]