SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014449 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014449
Domain Number 1 Region: 148-262
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-30
Family Phosphotyrosine-binding domain (PTB) 0.00031
Further Details:      
 
Domain Number 2 Region: 5-124
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000007
Family Phosphotyrosine-binding domain (PTB) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014449   Gene: ENSMLUG00000015858   Transcript: ENSMLUT00000015862
Sequence length 429
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430212:144396:148586:1 gene:ENSMLUG00000015858 transcript:ENSMLUT00000015862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMEDVAVKQGFLYLQQQQTFGKKWRRFGAVLYGQSGCALARLELQEGPEKPRRGEAARRV
IRLSDCLRVAEASGEASSPRDTSTFFLETKERLYLLAAPTAERSNWMQAICLLAFPGQRK
ELPGPEGKGSGPCMEENELYSSTTTGAPCKEFAVTMRPTEASERCRLRGAYTLRIGKGAL
ELWGGPEPRALLYDWAYRILRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALE
EAISAQKSVPPPGPQTQPAPAPGPAPAAAAAPAPAPAPAVLPRPESPYSRPHDSLPPPSP
SAPAPTSRPRGPEGEYAVPFDAVARNLGKSLRGILVVPPQPRADPLYDSIQEHPPSRSDH
IYDEPEGVAALSLYDSPQEPRGEAWRRQATADGDRSDPQHSYPVGQVFPAPGLPRETEYD
NVILKKGPK
Download sequence
Identical sequences G1PTA4
ENSMLUP00000014449 ENSMLUP00000014449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]