SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014463 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014463
Domain Number 1 Region: 197-537,618-642
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.53e-93
Family Myotubularin-like phosphatases 0.00000749
Further Details:      
 
Domain Number 2 Region: 18-163
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-26
Family GRAM domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014463   Gene: ENSMLUG00000015876   Transcript: ENSMLUT00000015878
Sequence length 751
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430966:40945:66046:1 gene:ENSMLUG00000015876 transcript:ENSMLUT00000015878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFQAEDAFDSEPKIKKLEPVLLPGEIVVNEVSFVRKCIATDTSQYDLWGKLICSNFKISF
ITDDPMPLQKFHYRNLLLGEHDVPLTCIEQIVTVNDHKRKQKVLGPNQKLKFNPTELIIY
CKDFRIVRFRFDESGPESAKKVCLAIAHYSQPTDLQLLFAFEYVGKKYHNSANTLNGIPT
GGGGGAGGGSSQKTPLFETYSDWDREVKRTGASGWRVCSINEGYMISTCLPEYFVVPSSL
ADQDLKTFSHSFVGRRMPLWCWSHSNGSALVRTALIKDLLQQRKIDQRICNAITKSHPQR
SDVCKSDLDKTLPNIQDIQVAFVKLKQLCVNEPFEETEERWLSSLEGTRWLEYVRAFLKH
SAELVYTLESRRVSVVLQEEEGRDLSCVVASLVQVMLDPYFRTIPGFQSLIQKEWVMSGY
QFLDRCNHLKRSEKESPLFLLFLDATWQLLDQYPAAFEFSETYLAVLGDSTRISLFGTFL
FNSPHQRVKQSTEFAISKNIQLGDEKGLKFPSVWDWSLQFTAKDRTLFHNPLYIGRSTPC
VRNSSVKAFKRTKKNYSSTLRGMPASLRNGLLSDQESLPRRNSLILQVRPDPPPHAQGQD
GGLEQFFREWRCKPADLHGVLLPHLSATHIKLWKLCYFRWVPEAQINRGGFVTAFHRLSL
LADEVDVLSRTLRQHRAGPLEACYAELDQSRMYFRARGPHDTSGTPEFLSSSFPFSPVGN
LCRRSISGTPLSKFLSGAKIWLSTETLANED
Download sequence
Identical sequences G1PTB5
ENSMLUP00000014463 ENSMLUP00000014463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]