SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014471 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014471
Domain Number 1 Region: 948-1079
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.07e-46
Family Regulator of G-protein signaling, RGS 0.00000618
Further Details:      
 
Domain Number 2 Region: 35-151
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.61e-21
Family Synaptotagmin-like (S variant) 0.0017
Further Details:      
 
Domain Number 3 Region: 183-264
Classification Level Classification E-value
Superfamily PDZ domain-like 2.53e-17
Family PDZ domain 0.0000158
Further Details:      
 
Domain Number 4 Region: 441-545
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000015
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014471   Gene: ENSMLUG00000015873   Transcript: ENSMLUT00000015889
Sequence length 1084
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429940:2689786:2793050:1 gene:ENSMLUG00000015873 transcript:ENSMLUT00000015889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRTGFCCSTIESHEFQKLSLSVGFSLAPAAKATLHPLFCAVTCLVMEGKGLMSKAPGIC
DPYVKISLIPEDQGLCCQKTQTVPDSRDPVFHEHFFFPVQEEDEQKRLLVAVWNRAGDSR
QSGLIGCMSFGVRSLLTPDKEISGWYYLLGEDLGRTKHLKVARRRLRPLRDPLLRMPGGE
DAENGEELKITIPRGKDGFGFTICCDSPVRVQAVDSGGPADRAGLQQLDTVLQLNERPVE
HWKCVELAHEIRSCPSEIILLVWRLVPQVKPGPDGGVLRRASCKSAHDLQLPPNKREKNC
AHGAQARPEQRHSCHLVCDSSDGLLLGGWERYTEVAKRGGQHTLPALSRATAPTDPNYII
LAPLNPGSQLLRPVYQEDAIPEESGSPSKGKSYTGLGKKSRLMKTVQTMKGHGNYQNCSV
MRPHTPHSSYGTYVTLAPKVLVFPIFVQPLDLCNPARTLLLSEELLLYEGRNKAAEVTLF
AYSDLLLFTKEDEPGRCNVLRNPLYLQSVKLQEGPSEDLKFCVLYLAEKAECLFTLEAHS
QEQKKRVCWCLSENIAKQQQLAASPPQSKMFESEVDEKREMPLEEGKGPGADDPPPSKDP
SPGQEPLLGQDLPLNKDSSSGQEPSPGQESLSSKDSASCQEPPPGQEPSPTKDSPPCQEP
PAAQALPPCQDLPAKQEPSPSQDPLLSQDLPTIQDPPAQDLSPCQDLPPSQAPEPAEALA
ETTGSEDPPAATGGLPVASRPAFVIPEVRLDSAYSQKAEAEGGSSGDEEDAEEAEEGDEG
EEDEDEDTSDDNYGEHSEAKRSSMIETGQGAEGGFSLRVQNSLRRRTHSEGSLLQEPRGP
CFSSDTTLNCSDGEGTTSSWAIPSPRTLKKELGRNGGSMHHLSLFFTGHRKMSGPDTVGD
NDEGSRKRKSKNLAKDMKNKLGIFRRRNESPGAQPAGKADKVMKSFKPTSEEALKWGESL
EKLLLHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMAAKAKKIFAEYIAIQA
CKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLVNQKKM
SPPL
Download sequence
Identical sequences G1PTC3
ENSMLUP00000014471 ENSMLUP00000014471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]