SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014476 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014476
Domain Number 1 Region: 315-632
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-81
Family Protein kinases, catalytic subunit 0.00000221
Further Details:      
 
Domain Number 2 Region: 128-228
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 1.03e-43
Family MAST3 pre-PK domain-like 0.0000126
Further Details:      
 
Domain Number 3 Region: 886-978
Classification Level Classification E-value
Superfamily PDZ domain-like 5.92e-19
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014476   Gene: ENSMLUG00000015877   Transcript: ENSMLUT00000015894
Sequence length 2363
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429767:43312485:43386450:-1 gene:ENSMLUG00000015877 transcript:ENSMLUT00000015894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGNSPQDSPRNFSPSASAHFSFARRTDGRRWSLASLPSSGYGTNTPSSTVSSSCSSQEKL
HQLPYQPTPDELHFLSKHFCTTESITTENRCRNTPMRPRSRSLSPGRSPACCDHEIIMMN
HVYKERFPKATAQMEDRLTDIITSYSPDHVLPLADGVLSFTHHQIIELARDCLDKSHQGL
ITSRYFLELQHKLDKLLQEAHERSESSELAFIKQLVRKILIVIARPARLLECLEFDPEEF
YYLLEAAEGHAKEGQGIKTDIPRYIISQLGLNKDPLEEMAQLGNYNSGTAETPETDESVS
SSNASLKLRRKPRESDFETIKLISNGAYGAVYFVRHKESRQRFAMKKINKQNLLLRNQVQ
QAFVERDILTFAENPFVVSMYCSFETRRHLCMVCDLLKRGDCATLMKNMGPLPVDMARMY
FAETVLALEYLHNYGIVHRDLKPDNLLVTSMGHIKLTDFGLSKVGLMSMTTNLYEGHIEK
DAREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGCVPFFGDTPEELFG
QVISDEINWPEKDEAPPPDAQDLITLLLRQNPLERLGTGGAYEVKQHRFFRSLDWNSLLR
QKAEFIPQLESEDDTSYFDTRSEKYHHMETEEEDDTNDEDFNVEIRQFSSCSHRFSKVFS
SIDRITQNAGEEKEDPGDKTKSTTLPSTETLSWSSEYSEMQQLSTSTSSDTESNRHKLSS
GLLPKLAISAEAEPDEAAPCPGDLREEPEKPVLPPAECAQEEPEVTTPASTISSSTLSVG
SFSEHLDQINGRSECVDNTDNPSKPPSEPASHMARQRLESTEKKKIAGKVTKSLSASALS
LMIPGDMFAVSPLGSPMSPHSLSSDPSSSRDSSPSRDSSAASASPHQPVVIHSSGKNYGF
TIRAIRVYVGDSDVYTVHHIVWNVEEGSPACQAGLKAGDLITHINGEPVHGLVHTEVIEL
LLKSGNKVSITTTPFENTSIKTGPARRNSYKSRMVRRSKKSKKKESLERRRSLFKKLAKQ
PSPLLHTSRSFSCLNRSLSSGESLPGSPTHSLSPRSPTPSYRSTPDFPSGTNSSQSSSPS
SSAPNSPAGSGHIRPSTLHGLAPKLSGQRYRSGRRKSAGNIPLSPLARTPSPTPQPTSPQ
RSPSPLLGPPLGNAKIVQAFPSKMHSPPTIVRHIVRPKSAEPPRSPLLKRVQSEEKLSPA
YSSDKKHLCSRKHSLEVTQEEVQREPSQREVTLQSLEETACDTPALSRARPVEQGCLKRP
ASRKLGRQESVDDLDREKLKAKVVVKKPDGFPEKPEPHPKSHPLGSDSENHSAVRLEERE
KKMYPKMLERSNHFENKAAGQEAPAPGGLLKGALHKPASASAGAAAGRGQAPADHSQGTC
DGKPASAPSTLQDGPCPSPDRSAAGRGDAVEKAPQAKECLRCEKLDSKLASMDYLRKKVS
LEDKDDNLCLMLKPKMTSSAHECLPGNAVRPTGGQQEAPASESRVFSSSAHAAPMGGVVF
VPLKALAGRVDGGAEKPGPVAPEPPARKSPSEYKLEGRSVSCLKPIEGTLDIALLSGPQA
SKIELPSPEPMQSPGPGPGSALGPAAPPALPSDGRKGDAAGQRSPPAGFKVNKSYLLEPR
FLPPSRGLQNSPSAPQPDPALKQDRNVSQATRSPATDTENDPQRREGGPSKRQDPSSNMK
CLPALGQTLRGADPSRAPGPPPPEGVPSREKPSGREPTERGPSTARTEPQAARAAVRREP
SMEPSPPQAAKTGDNRNLPSVGGARSDVHTQTLATEKARGPCGKPSHRDGREEVRPLARE
DPSLHPVGTGTPCERELGKGRSGPEPTSQAPPARQSLQPPEGGKSDKLRSFPSLQRDDPR
EPERKEQLQQQLSSGSQPPPVTKDLPSPARQPCGAPSPSSGRELGSKPWAAEPSLGLPDP
PRPAAVHGESSHKPGPAPDPSPAKSKHPDRPLASQRLGMGAAVAREPGTQPLSGPSSPSG
PSRDGKGSSKGVSNVYPALPGSQNTASHVIGQGGSGPSGSLPPKAGPLDTKLKPTEGGRA
PEALERPVHPPRQGHPGVSESVDQKLPTVSEKLNLSPKHPKPPTVRDGPPPCRQTDKSPS
PLAATADRKSEGKKCMEALYGPTDGRKLEASLPLAQGEARLRGTEKPAGAAGKGLPDAKG
RGLSAQKPPPEAGKPSGMKRSPSAIGQSSFRPTALPEKCLSTSSSFPEARPGAREAPAAS
SDPASAKASGATAEPTAPSSRDQRKPPSGGDGGSHMTKSDSLPSFRSSSITVELQHPNPT
TAWGAGPRGRALSVTAPPGETKEREPAPAQPQTRKQNAGREVTKPSPAPGTDRPVAPSSE
KDSVVRQRRGKEGLRSSPHKKAS
Download sequence
Identical sequences G1PTC7
ENSMLUP00000014476 ENSMLUP00000014476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]