SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014508 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014508
Domain Number 1 Region: 87-182
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-30
Family PDZ domain 0.015
Further Details:      
 
Domain Number 2 Region: 9-63
Classification Level Classification E-value
Superfamily L27 domain 4.71e-26
Family L27 domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014508   Gene: ENSMLUG00000015928   Transcript: ENSMLUT00000015928
Sequence length 197
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429859:710060:717210:-1 gene:ENSMLUG00000015928 transcript:ENSMLUT00000015928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WRLLGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYET
VDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYIS
RIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEE
MESRFEKMRSAKRRQQT
Download sequence
Identical sequences G1PTF7
ENSMLUP00000014508 ENSMLUP00000014508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]