SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014517 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014517
Domain Number 1 Region: 2-209
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-79
Family Protein kinases, catalytic subunit 0.0000248
Further Details:      
 
Domain Number 2 Region: 593-704
Classification Level Classification E-value
Superfamily KA1-like 1.8e-47
Family Kinase associated domain 1, KA1 0.00000334
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000014517
Domain Number - Region: 228-266
Classification Level Classification E-value
Superfamily UBA-like 0.0177
Family UBA domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014517   Gene: ENSMLUG00000015922   Transcript: ENSMLUT00000015937
Sequence length 704
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430563:196821:236989:-1 gene:ENSMLUG00000015922 transcript:ENSMLUT00000015937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFREVRIMKILNHPNIVKLFEVIETDKTLYLIMEYASGGEVFDYLVAHGRMKEKEARAKF
RQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTVGSKLDTFCGSPPYA
APELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTD
CENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMG
YSQEEIQESLSKMKYDEITATYLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQ
SPHHKVQRSVSSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTADGDLKADGAPSRRAGSSA
GGGKGMAPASPMLGNASNPNKADIPERKTSSTVPNSNTASGGMTRRNTYVCSERTTADRH
SVIQNGKESSSLSEIVLICPSAPSVGETVTAAGGGWRLRHQKSMSMPASGPPKMLLPPLD
SEGGNVQAVTVPDQRTPVASTHSISSAATPDRVRFPRGTASRSTFHGQPRERRTATYNGP
PASPSLSHEATPLSQARSRGSANLFSKLTSKLTRRLPTEYERNGRYEGSSRNVSAEQKDE
NKEAKPRSLRFTWSMKTTSSMDPSDMMREIRKVLDANNCDYEQRERFLLFCVHGDGHAES
LVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL
Download sequence
Identical sequences G1PTG5
ENSMLUP00000014517 ENSMLUP00000014517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]