SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014531 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014531
Domain Number 1 Region: 364-546
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 287-343
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000855
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000014531
Domain Number - Region: 34-110
Classification Level Classification E-value
Superfamily Tropomyosin 0.00883
Family Tropomyosin 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014531   Gene: ENSMLUG00000015945   Transcript: ENSMLUT00000015952
Sequence length 638
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429858:3720981:3741640:-1 gene:ENSMLUG00000015945 transcript:ENSMLUT00000015952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METTMLNLRNLFEQLVRRVEILSEGNELLSLLSLEFIQLAKDFEDFRKKWQRTDQELGKY
KDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGS
IQLSEEQKSALAFLNRGQPSIGNAGNKRLSTIDESGSILSDISFDKTDESLDWDSSVIKT
FKLKKREKRRSNSRQFVDGPPGPIKKTRSIGSTADQGNESIVAKTTVTVPSDGGPIEATS
TIETVPYWTRSRRKTGTLQPWNSDSTLSSRPLEPRTETDGSSTPQSSGGMRLHDFVSKTV
IKPESCVPCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPCIPTLIGTPVKIGEGILADY
VSQTSPMIPSIIVHCVNEIEQRGLTETGLYRVSGCDRTVKELKEKFLRVKTVPLLSKVDD
IHAICSFLKDFLRNLKEPLLTFRLNKTFMGAAEITDEDNSIAAMYQAVGELPQANRDTLA
FLMIHLQRVAQSPNTKMDIANLAKVFGPTIVAHAVPNPDPMTMVQDIKRQPKVVERLLSL
PLEYWSQFMMVEQENIDPMHVIENSNAFSTPQTPDVKVSLLGPVTTPEHQLLKTPSSSSL
SQRVRSTLTRNTPRFGSKSKSATNLGRQGNFFASPMLK
Download sequence
Identical sequences G1PTH8
ENSMLUP00000014531 ENSMLUP00000014531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]