SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014535 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014535
Domain Number 1 Region: 3-300
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.51e-54
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014535   Gene: ENSMLUG00000015955   Transcript: ENSMLUT00000015956
Sequence length 315
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:5367936:5384608:-1 gene:ENSMLUG00000015955 transcript:ENSMLUT00000015956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGQHLPVPRLEGVSQEHFMQHLYPQRKPVVLEGIDLGTCTSKWTVEYLSQVGGRKEVKI
HVAAVPQMDFISKNFVYRYFLLXXXXXXXXXEKHKEFFISEDEKYYLRSLGEDPRKDVAD
IRKQFPLLEEDIKFPKFFKEEQFFSSVFRISSPGLQLWTHYDVMDNFLIQVTGKKRVVLF
SPRDAQYLYLSGTKSEVLNIDDPDLAKYPLFSKARRYECSLNAGDVLFIPALWFHNVISE
EFGVGVNVFWKHLPSECYDKTDTYGNKDLTAASRAAQILDRALKTLAELPEEYRDFYARR
MVLHIQDKAYSKNFE
Download sequence
Identical sequences G1PTI1
ENSMLUP00000014535 ENSMLUP00000014535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]