SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014539 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014539
Domain Number 1 Region: 139-268
Classification Level Classification E-value
Superfamily PX domain 2.75e-32
Family PX domain 0.0011
Further Details:      
 
Domain Number 2 Region: 308-519
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000023
Family BAR domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014539   Gene: ENSMLUG00000015949   Transcript: ENSMLUT00000015960
Sequence length 521
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429882:2512172:2554879:-1 gene:ENSMLUG00000015949 transcript:ENSMLUT00000015960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKPQYPK
RITSFPISNGSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKKVPAKTLISLPPQEA
TNSSKPQQSYEELEEEEQEDQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPMFRSKQF
AVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAA
LERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLSGAGLLKMFNKATDAVSKMTIK
MNESDIWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKSLAMLGSSEDNT
ALSRALSQLAEVEEKVEQLHQEQANSDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQRWQ
DAQATLQKKREAEARLLWANKPDKLQQAKDEIVEWESRVTQYERDFERISTVVRKEVIRF
EKEKSKDFRNHVIKYLETLLYSQQQLAKYWEAFLPEAKAIS
Download sequence
Identical sequences G1PTI5
ENSMLUP00000014539 ENSMLUP00000014539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]