SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014552 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014552
Domain Number 1 Region: 42-206
Classification Level Classification E-value
Superfamily Cyclophilin-like 5.11e-74
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014552   Gene: ENSMLUG00000015974   Transcript: ENSMLUT00000015976
Sequence length 216
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429882:2481318:2488160:1 gene:ENSMLUG00000015974 transcript:ENSMLUT00000015976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLSERNMKLLFVAALIVGSVVFLLLPGPSTADEKKKGPKVTVKVYFDLRIGDEDIGRV
VIGLFGKTVPKTVDNFVALATGEKGFGYKDSKFHRVIKDFMIQGGDFTRGDGTGGKSIYG
ERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVR
KVESTKTDGRDKPLKDVIIADCGKIEVEKPFAIAKE
Download sequence
Identical sequences G1PTJ8 L5LFS6
ENSMLUP00000014552 ENSMLUP00000014552 XP_006093465.1.53796 XP_006770848.1.95426 XP_008137359.1.99482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]