SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014596 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014596
Domain Number 1 Region: 1067-1203,1293-1577
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.62e-109
Family Myotubularin-like phosphatases 0.00000433
Further Details:      
 
Domain Number 2 Region: 1647-1842
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-28
Family Pleckstrin-homology domain (PH domain) 0.00000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014596   Gene: ENSMLUG00000015995   Transcript: ENSMLUT00000016023
Sequence length 1845
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430845:5118:24154:1 gene:ENSMLUG00000015995 transcript:ENSMLUT00000016023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRCSDPLLLSSGSGEGQGQILQRFPEKDWEDNPFPQGIELFCQPSGWQLCPERNPPTFFV
AVLTDINSERHYCACLTFWEPAEPAQEAVCSEDAAGREEEAGEGGSGRLSPGTPGPPGQL
FAPKTLVLVSRLDHVEVFRNSLGLIYTIHVEGLNVGLETVVGNLLTCIIPLAGGSQRTIS
LGAGDRQVIQTPLTDSLPISRCSVALLFRQLGITNVLSLFCAALTEHKVLFLSRSYQRLS
EACRGLLALLFPLRYSFTYVPILPAQLLEVLSTPTPFIIGVNAAFQAETQELLDVIVADL
DGGTVTVPECVHIPPLPEPLQSQTHSVLSMVLDPELELADLAFPPPTISSSSLKMQDKEL
RAVFLRLFAQLLQGYRWCLHMVRIHPEPVIRFHKAAFLGQRGLVEDDFLMKVLEGMAFAG
FVSERGVPYRPTDLFDELVAHEVARMRADESHPQRVLRHVKELAEQLYKNENPYPAVAMH
KVQRPGEASHLRRAPRPFPRLDEGMVQWIVDQATAKMQGAPPAVKAERRTTVPSGPPMTA
ILERSSGLHGNSARRLEVVRNCISYVFEGKMLEAKKVRALGTGGAGCGGSGPQLGLLTFH
QLRELGWQEGQWVPGLRSLQLSGVQTAPLPFPAPPPPKVSSSFTESVDPHVFLKNEKRIE
KGTHSLLLVVLTTAGGRGTAVRVPPATAAGPGGGSSSRCPVSSRLVLGRRPGELAERCAV
LCSGPVCALADARAACILLPLPPRAVALGARPPGHSGWSLCSQSRALSLCAPSPAAPRCA
EALKGRAARRCLPRSCTCMCSRPRVWTTAVRLCRPHDELLLPLRSPHLESVSGVCCISSA
RPKCTQPHWLVARACVPSAGGAPLERHTRQPQVCTAGRRGKGALHSRALGLPRPLGPIWS
QGVDHPSRSGGTGLPVGSPASVVVARPGAAQTSEALCLMQLLKMAFDEEVGSENAELFRK
QLHKLRYPLDIRNTFAFTQGSAHTPGRPPRTAKDKGPSLRTLSRNLVKNAKKTMGRQHVT
RKKYNPPSYEHRGQSPDDQEDEISVSEELEPGTLTPTSALKPSDRMTMSSLVERACCRDY
QRLGLGTLSSSLSRAKSEPFRISPVNRMYAICRSYPGLLIVPQSVQDNALQRVSRCYRQN
RFPVVCWRSGRSKAVLLRSGGLHGKGVVGLFKAQNTPSPGQSQADSSSLEQEKYLQAVVS
SMPRYADTSGRNTLSGFSSAHMGSHAVPPVPSPRARVTTLSNPMAASASRRTAPRGKWGS
VRASGRSGGLGGDVGSRLAGRDMRGPPQANGAPPDSGFPRPQRAALYIIGDKAQFKGVRP
DPLQQWALVPIEMFEARQVKTSFKKLLKACVPGCQDFESGPTFLRSLEDSEWLTQIHKLL
HVSVMVVELLDSGSSVLVSLEDGWDITTQVVSLVQLLSDPFYRTLEGFRLLVEKEWLSFG
HRFSHRGAHTLGQSSGFTPVFLQFLDCVHQVHLQFPMEFEFSPFYLKFLGYHHVSRRFRT
FLLDSDYERIELGLLYEEKGERKGPQACRSVWEYVDRLSKRTPVFYNYMYAPEDTEVLRP
YSNVSNLKVWDFYTEETLAQGPPYDWELAQVSPEPPEEERPDGGAPQSRRRVVWPCYDSR
PRAQPDAISRLLEELQRLETELGRPPERWKDNWDRVKAAQRLEGRPDGRGTPSSLLVSSV
PHHRRSLGVYLQEGPVGSTLSLSLDSDQSSGSTTSGSRQAARRSTSTLYSQFQTAESENR
SYEGTLYKKGAFMKPWKARWFVLDKTKHQLRYYDHRVDTECKGVIDLAEVEAVVPGTPTM
GAPKTVDEKAFFDVKTTRRVYNFCAQDVPSAQQWVDQIQSCLSDA
Download sequence
Identical sequences G1PTN5
ENSMLUP00000014596 ENSMLUP00000014596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]